BARX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BARX2_MOUSE
• UniProt AC: O08686
• Protein Name: Homeobox protein BarH-like 2
• Gene Name: Barx2
• Organism: Mus musculus (Mouse).
• Sequence Length: 283
• Subcellular Localization: Nucleus.
• Protein Description: Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. May be involved in controlling adhesive processes in keratinizing epithelia..
• Protein Sequence: MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQPTVISHLVPTGSGLTPVLTRHPVAAAEAAAAAAETPGGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLESSERQEEPCDTQEPKACLVPLEVAEPIHQPQELSEASSEPPPLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	HAELRLSSPGQLKAA CEEEECCCHHHHHHH	37.33	24719451
22	Phosphorylation	LKAARRRYKTFMIDE HHHHHHHHHHHHHHH	16.75	19854140
24	Phosphorylation	AARRRYKTFMIDEIL HHHHHHHHHHHHHHH	14.97	19854140
35	Phosphorylation	DEILSKETCDYFEKL HHHHCHHCCCHHHHH	17.89	19854140
38	Phosphorylation	LSKETCDYFEKLSLY HCHHCCCHHHHHCHH	18.78	19854140
215	Phosphorylation	KGRPKKNSIPTSEEI CCCCCCCCCCCHHHH	38.53	23375375
218	Phosphorylation	PKKNSIPTSEEIEAE CCCCCCCCHHHHHHH	47.29	25367039
219	Phosphorylation	KKNSIPTSEEIEAEE CCCCCCCHHHHHHHH	28.07	25367039
230	Phosphorylation	EAEEKMNSQAQSQEL HHHHHHHHHHHHHHH	24.32	25367039
234	Phosphorylation	KMNSQAQSQELLESS HHHHHHHHHHHHHCH	28.74	25367039
240	Phosphorylation	QSQELLESSERQEEP HHHHHHHCHHHCCCC	37.15	25367039
241	Phosphorylation	SQELLESSERQEEPC HHHHHHCHHHCCCCC	27.67	25367039

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BARX2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BARX2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BARX2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CREB1_MOUSE	Creb1	physical	20211142
FOS_MOUSE	Fos	physical	20211142
JUN_MOUSE	Jun	physical	20211142
TLE1_MOUSE	Tle1	physical	15728386

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.