ATL52_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATL52_ARATH
• UniProt AC: Q9LF64
• Protein Name: RING-H2 finger protein ATL52
• Gene Name: ATL52
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 362
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MSTNPNPWSPYDSYNDCSQGICNIYCPQWCYLIFPPPPPSFFLDDDSSSSSSSFSPLLIALIGILTSALILVSYYTLISKYCHRHHQTSSSETLNLNHNGEGFFSSTQRISTNGDGLNESMIKSITVYKYKSGDGFVDGSDCSVCLSEFEENESLRLLPKCNHAFHLPCIDTWLKSHSNCPLCRAFVTGVNNPTASVGQNVSVVVANQSNSAHQTGSVSEINLNLAGYESQTGDFDSVVVIEDLEIGSRNSDARSELQLPEERRETKDEDSLPIRRSVSLNSGVVVSIADVLREIEDEEGESGGVGTSQRREEGEDGDGKTIPPTEANQRSGGVSGFFVRSLSTGRFIFSRYDRGRNYRLPL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	LNESMIKSITVYKYK CCHHHEEEEEEEEEC	16.74	28011693
126	Phosphorylation	ESMIKSITVYKYKSG HHHEEEEEEEEECCC	25.52	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATL52_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATL52_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATL52_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC34_ARATH	UBC34	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.