UniProt ID | ASCL2_HUMAN | |
---|---|---|
UniProt AC | Q99929 | |
Protein Name | Achaete-scute homolog 2 | |
Gene Name | ASCL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 193 | |
Subcellular Localization | Nucleus . | |
Protein Description | AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.. | |
Protein Sequence | MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | AARRRPASPELLRCS CCCCCCCCHHHHHCC | 22.91 | 25849741 | |
42 | Phosphorylation | SRRRRPATAETGGGA CCCCCCCCCCCCCHH | 27.92 | - | |
45 | Phosphorylation | RRPATAETGGGAAAV CCCCCCCCCCHHHHH | 38.37 | - | |
87 | Phosphorylation | GGASKKLSKVETLRS CCCCCCHHHHHHHHH | 43.46 | 29083192 | |
91 | Phosphorylation | KKLSKVETLRSAVEY CCHHHHHHHHHHHHH | 30.38 | 27174698 | |
94 | Phosphorylation | SKVETLRSAVEYIRA HHHHHHHHHHHHHHH | 39.52 | 27174698 | |
98 | Phosphorylation | TLRSAVEYIRALQRL HHHHHHHHHHHHHHH | 6.79 | 27174698 | |
136 | Phosphorylation | APRGPPGTTPVAASP CCCCCCCCCCCCCCC | 33.43 | 25841592 | |
137 | Phosphorylation | PRGPPGTTPVAASPS CCCCCCCCCCCCCCC | 22.98 | 25841592 | |
142 | Phosphorylation | GTTPVAASPSRASSS CCCCCCCCCCCCCCC | 17.42 | 25849741 | |
144 | Phosphorylation | TPVAASPSRASSSPG CCCCCCCCCCCCCCC | 37.67 | 25841592 | |
147 | Phosphorylation | AASPSRASSSPGRGG CCCCCCCCCCCCCCC | 30.18 | 23312004 | |
148 | Phosphorylation | ASPSRASSSPGRGGS CCCCCCCCCCCCCCC | 39.30 | 23312004 | |
149 | Phosphorylation | SPSRASSSPGRGGSS CCCCCCCCCCCCCCC | 28.95 | 22210691 | |
155 | Phosphorylation | SSPGRGGSSEPGSPR CCCCCCCCCCCCCCC | 34.06 | 24719451 | |
156 | Phosphorylation | SPGRGGSSEPGSPRS CCCCCCCCCCCCCCC | 51.60 | 24719451 | |
160 | Phosphorylation | GGSSEPGSPRSAYSS CCCCCCCCCCCCCCC | 28.05 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASCL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASCL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASCL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NCOA6_HUMAN | NCOA6 | physical | 12482968 | |
RBBP5_HUMAN | RBBP5 | physical | 12482968 | |
TBA1A_HUMAN | TUBA1A | physical | 12482968 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...