ARPC3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARPC3_SCHPO
• UniProt AC: Q9Y7J4
• Protein Name: Actin-related protein 2/3 complex subunit 3
• Gene Name: arc3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 174
• Subcellular Localization: Cytoplasm, cytoskeleton, actin patch.
• Protein Description: Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks..
• Protein Sequence: MPAYHSSFLSLTDVPTTGNIAMLPLKTKFRGPAYPADESQMDIIDECIGLFRANCFFRNFEIKGPADRTLIYGTLFISECLGRVNGLNYRDAERQLNSLALENFSIPGSAGFPLNALYAPPLSPQDAEIMRTYLTQFRQELAYRLLSHVYATEKDHPSKWWTCFSKRRFMNKAL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ARPC3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARPC3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARPC3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARPC3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARP3_SCHPO	arp3	physical	20668161
RPN1_SCHPO	mts4	physical	20668161
ARP3_SCHPO	arp3	physical	21449051
ARPC4_SCHPO	arc4	physical	21449051

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.