dbPTM

ARPC3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ARPC3_ARATH
UniProt AC	Q1ECJ7
Protein Name	Actin-related protein 2/3 complex subunit 3
Gene Name	ARPC3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	174
Subcellular Localization	Cytoplasm, cytoskeleton. Cell projection.
Protein Description	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development..
Protein Sequence	MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPVSEQDKTDIVDEAITFFRANVFFTNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAVGTKAIINLGLEDIPVPGETGFPFPGLFSLPQSQDEAELFRNYLKQVREETSGRLLSVAYRANGTPNKWWLAFAKRKFMNVVVL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ARPC3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ARPC3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ARPC3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ARPC3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SCAR2_ARATH	SCAR2	physical	15659634
WASF1_HUMAN	WASF1	physical	15659634
ARPC4_ARATH	ARPC4	physical	17267444
P2C56_ARATH	ABI1	physical	17267444
P2C77_ARATH	ABI2	physical	17267444
BRK1_ARATH	BRK1	physical	17267444
SCAR1_ARATH	WAVE1	physical	17267444
SCAR2_ARATH	SCAR2	physical	17267444
SCAR3_ARATH	WAVE2	physical	17267444

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ARPC3_ARATH

Related Literatures of Post-Translational Modification