UniProt ID | ARPC3_ARATH | |
---|---|---|
UniProt AC | Q1ECJ7 | |
Protein Name | Actin-related protein 2/3 complex subunit 3 | |
Gene Name | ARPC3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 174 | |
Subcellular Localization | Cytoplasm, cytoskeleton. Cell projection. | |
Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development.. | |
Protein Sequence | MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPVSEQDKTDIVDEAITFFRANVFFTNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAVGTKAIINLGLEDIPVPGETGFPFPGLFSLPQSQDEAELFRNYLKQVREETSGRLLSVAYRANGTPNKWWLAFAKRKFMNVVVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ARPC3_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SCAR2_ARATH | SCAR2 | physical | 15659634 | |
WASF1_HUMAN | WASF1 | physical | 15659634 | |
ARPC4_ARATH | ARPC4 | physical | 17267444 | |
P2C56_ARATH | ABI1 | physical | 17267444 | |
P2C77_ARATH | ABI2 | physical | 17267444 | |
BRK1_ARATH | BRK1 | physical | 17267444 | |
SCAR1_ARATH | WAVE1 | physical | 17267444 | |
SCAR2_ARATH | SCAR2 | physical | 17267444 | |
SCAR3_ARATH | WAVE2 | physical | 17267444 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...