| UniProt ID | ARP3_ARATH | |
|---|---|---|
| UniProt AC | Q9SAF1 | |
| Protein Name | Actin-related protein 3 | |
| Gene Name | ARP3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 427 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament (By similarity). Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development. Involved in the control of cell morphogenesis in leaf epidermal pavement cells, root hairs, hypocotyls epidermal cells and trichomes, especially during rapid cell expansion. Regulates the directionality of cell expansion by regulating the actin organization, and thus the microtubules distribution and the fusion of small vacuoles.. | |
| Protein Sequence | MDPTSRPAIVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSKSSSKATWQTQHNAGVAADLDFYIGDEALAKSRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEILFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGATHVVPVAEGYVIGSCIKSIPIAGKDVTLFIQQLMRERGENIPPEDSFDVARKVKEMYCYTCSDIVKEFNKHDKEPAKYIKQWKGVKPKTGAPYTCDVGYERFLGPEVFFNPEIYSNDFTTTLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKDFGRRLQRDLKKIVDARVLANNARTGGEITSQPVEVNVVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASICRTNPVFKGMY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 335 | Phosphorylation | IVLSGGSTMFKDFGR EEECCCCHHHHHHHH | 29.87 | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARP3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARP3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARP3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| P2C56_ARATH | ABI1 | physical | 17267444 | |
| P2C77_ARATH | ABI2 | physical | 17267444 | |
| ABI4_ARATH | ABI4 | physical | 17267444 | |
| BRK1_ARATH | BRK1 | physical | 17267444 | |
| SCAR3_ARATH | WAVE2 | physical | 17267444 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...