ARP3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARP3_ARATH
• UniProt AC: Q9SAF1
• Protein Name: Actin-related protein 3
• Gene Name: ARP3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 427
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament (By similarity). Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development. Involved in the control of cell morphogenesis in leaf epidermal pavement cells, root hairs, hypocotyls epidermal cells and trichomes, especially during rapid cell expansion. Regulates the directionality of cell expansion by regulating the actin organization, and thus the microtubules distribution and the fusion of small vacuoles..
• Protein Sequence: MDPTSRPAIVIDNGTGYTKMGFAGNVEPCFILPTVVAVNESFLNQSKSSSKATWQTQHNAGVAADLDFYIGDEALAKSRSSSTHNLHYPIEHGQVEDWDAMERYWQQCIFNYLRCDPEDHYFLLTESPLTPPESREYTGEILFETFNVPGLYIAVNSVLALAAGYTTSKCEMTGVVVDVGDGATHVVPVAEGYVIGSCIKSIPIAGKDVTLFIQQLMRERGENIPPEDSFDVARKVKEMYCYTCSDIVKEFNKHDKEPAKYIKQWKGVKPKTGAPYTCDVGYERFLGPEVFFNPEIYSNDFTTTLPAVIDKCIQSAPIDTRRALYKNIVLSGGSTMFKDFGRRLQRDLKKIVDARVLANNARTGGEITSQPVEVNVVSHPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASICRTNPVFKGMY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
335	Phosphorylation	IVLSGGSTMFKDFGR EEECCCCHHHHHHHH	29.87	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARP3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARP3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARP3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P2C56_ARATH	ABI1	physical	17267444
P2C77_ARATH	ABI2	physical	17267444
ABI4_ARATH	ABI4	physical	17267444
BRK1_ARATH	BRK1	physical	17267444
SCAR3_ARATH	WAVE2	physical	17267444

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.