UniProt ID | ABI4_ARATH | |
---|---|---|
UniProt AC | A0MES8 | |
Protein Name | Ethylene-responsive transcription factor ABI4 {ECO:0000303|PubMed:9634591} | |
Gene Name | ABI4 {ECO:0000303|PubMed:9634591} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 328 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription regulator that probably binds to the GCC-box pathogenesis-related promoter element. Binds also to the S-box (5'-CACTTCCA-3') photosynthesis-associated nuclear genes-related (PhANGs-related) promoter element, and thus acts as a transcription inhibitor. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. May have a function in the deetiolation process. Confers sensitivity to abscisic acid (ABA), and regulates the ABA signaling pathway during seed germination, upon nitrate-mediated lateral root inhibition, in hexokinase-dependent sugar responses (including feed-back regulation of photosynthesis and mobilization of storage lipid during germination), and in response to osmotic stress mediated by NaCl, KCl or mannitol. Plays a role in sucrose sensing or signaling, especially at low fluence far red light. Also involved in plant response to glucose treatment, especially at low concentration and in young seedlings. Required for the trehalose-mediated root inhibition and starch accumulation in cotyledons, probably by inhibiting starch breakdown. However, seems to not be involved in sugar-mediated senescence. Required for the ABA-dependent beta-amino-butyric acid (BABA) signaling pathway. BABA primes ABA synthesis and promotes resistance to drought and salt, and leads to a prime callose accumulation that confers resistance against necrotrophic pathogens such as A.brassicicola and P.cucumerina. Seems to be involved in resistance to S.sclerotiorum probably by regulating the ABA-mediated stomatal closure apparently by antagonistic interaction with oxalate. Negative regulator of low water potential-induced Pro accumulation whose effect is decreased by high levels of sugar.. | |
Protein Sequence | MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSSSSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLCPSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVALGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTIWPFGGEEEYSHNWGSIWDFIDPILGEFY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ABI4_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABI4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABI4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABI4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ABI3_ARATH | ABI3 | physical | 11489176 | |
BRK1_ARATH | BRK1 | physical | 17267444 | |
SCAR2_ARATH | SCAR2 | physical | 17267444 | |
SCAR3_ARATH | WAVE2 | physical | 17267444 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...