ABI4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ABI4_ARATH
• UniProt AC: A0MES8
• Protein Name: Ethylene-responsive transcription factor ABI4 {ECO:0000303|PubMed:9634591}
• Gene Name: ABI4 {ECO:0000303|PubMed:9634591}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 328
• Subcellular Localization: Nucleus .
• Protein Description: Transcription regulator that probably binds to the GCC-box pathogenesis-related promoter element. Binds also to the S-box (5'-CACTTCCA-3') photosynthesis-associated nuclear genes-related (PhANGs-related) promoter element, and thus acts as a transcription inhibitor. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. May have a function in the deetiolation process. Confers sensitivity to abscisic acid (ABA), and regulates the ABA signaling pathway during seed germination, upon nitrate-mediated lateral root inhibition, in hexokinase-dependent sugar responses (including feed-back regulation of photosynthesis and mobilization of storage lipid during germination), and in response to osmotic stress mediated by NaCl, KCl or mannitol. Plays a role in sucrose sensing or signaling, especially at low fluence far red light. Also involved in plant response to glucose treatment, especially at low concentration and in young seedlings. Required for the trehalose-mediated root inhibition and starch accumulation in cotyledons, probably by inhibiting starch breakdown. However, seems to not be involved in sugar-mediated senescence. Required for the ABA-dependent beta-amino-butyric acid (BABA) signaling pathway. BABA primes ABA synthesis and promotes resistance to drought and salt, and leads to a prime callose accumulation that confers resistance against necrotrophic pathogens such as A.brassicicola and P.cucumerina. Seems to be involved in resistance to S.sclerotiorum probably by regulating the ABA-mediated stomatal closure apparently by antagonistic interaction with oxalate. Negative regulator of low water potential-induced Pro accumulation whose effect is decreased by high levels of sugar..
• Protein Sequence: MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSSSSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLCPSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVALGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTIWPFGGEEEYSHNWGSIWDFIDPILGEFY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ABI4_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ABI4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ABI4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ABI4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABI3_ARATH	ABI3	physical	11489176
BRK1_ARATH	BRK1	physical	17267444
SCAR2_ARATH	SCAR2	physical	17267444
SCAR3_ARATH	WAVE2	physical	17267444

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.