UniProt ID | ARL13_CAEEL | |
---|---|---|
UniProt AC | H2L0N8 | |
Protein Name | ADP-ribosylation factor-like protein 13B | |
Gene Name | arl-13 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 370 | |
Subcellular Localization |
Cell projection, cilium membrane Lipid-anchor . Associates to the cilium membrane via palmitoylation. Localizes to proximal ciliary membranes, to an inversin-like subciliary membrane compartment, excluding the transition zone. |
|
Protein Description | Cilium-specific protein required to control the microtubule-based, ciliary axoneme structure. Required for normal sensory cilium function. May act by maintaining the association between IFT subcomplexes A and B.. | |
Protein Sequence | MTEKSWFETIFCCCCHRTPIIRREIKLGCFGIGSAGKTTFLKVLKGEDPRDLLRTNGFSTVKMEYDETFHLTIYDVGGDKGIRGIWSNYYAEVHGIIYVIDYSTDETFTESIEALHSLTSNPHVQKKPIFLLLNNQNNREFDDVEISNETKIQAGQHKIVLFSHFNKYNGYLDNIKSATLTVMARAKKDRNEYQEQFVRFIDSISEHYVELSEGVKTAELALRIRQEEAKEQRRLMQMKVEHDALKADVAGLELRNQPPVQPPIPPDPPSDPKSASVHIEESPPMSLASSTIPSDIIQSTPETGTPRDPVNFCRISQTSTKPVSPESNSVKEEPTIILKDNYFLPPKAPGRQYSRIQRIQNVLNNRVVPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | S-palmitoylation | SWFETIFCCCCHRTP CHHHHHHHHHHCCCH | 20231383 | ||
13 | S-palmitoylation | WFETIFCCCCHRTPI HHHHHHHHHHCCCHH | 20231383 | ||
14 | S-palmitoylation | FETIFCCCCHRTPII HHHHHHHHHCCCHHH | 20231383 | ||
15 | S-palmitoylation | ETIFCCCCHRTPIIR HHHHHHHHCCCHHHC | 20231383 | ||
239 | Sumoylation | QRRLMQMKVEHDALK HHHHHHHHHHHHHHH | 23128241 | ||
331 | Sumoylation | SPESNSVKEEPTIIL CCCCCCCCCCCEEEE | 23128241 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL13_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL13_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL13_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC9_CAEEL | ubc-9 | physical | 23128241 | |
MEL26_CAEEL | mel-26 | physical | 23128241 | |
DIM_CAEEL | dim-1 | physical | 23128241 | |
PSA7_CAEEL | pas-4 | physical | 23128241 | |
RS4_CAEEL | rps-4 | physical | 23128241 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...