UniProt ID | APOC2_HUMAN | |
---|---|---|
UniProt AC | P02655 | |
Protein Name | Apolipoprotein C-II | |
Gene Name | APOC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization | Secreted . | |
Protein Description | Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL.. | |
Protein Sequence | MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Sulfoxidation | GTRLLPALFLVLLVL CCCHHHHHHHHHHHH | 3.01 | 18729385 | |
23 | O-linked_Glycosylation | LGFEVQGTQQPQQDE HCCCCCCCCCCCCCC | 13.62 | OGP | |
33 | O-linked_Glycosylation | PQQDEMPSPTFLTQV CCCCCCCCCCHHHHH | 34.95 | OGP | |
35 | O-linked_Glycosylation | QDEMPSPTFLTQVKE CCCCCCCCHHHHHHH | 35.30 | OGP | |
43 | O-linked_Glycosylation | FLTQVKESLSSYWES HHHHHHHHHHHHHHH | 28.03 | OGP | |
43 | Phosphorylation | FLTQVKESLSSYWES HHHHHHHHHHHHHHH | 28.03 | 22461510 | |
45 | O-linked_Glycosylation | TQVKESLSSYWESAK HHHHHHHHHHHHHHH | 30.57 | OGP | |
46 | O-linked_Glycosylation | QVKESLSSYWESAKT HHHHHHHHHHHHHHH | 39.29 | OGP | |
47 | Phosphorylation | VKESLSSYWESAKTA HHHHHHHHHHHHHHH | 15.15 | 22461510 | |
50 | O-linked_Glycosylation | SLSSYWESAKTAAQN HHHHHHHHHHHHHHH | 22.40 | OGP | |
50 | Phosphorylation | SLSSYWESAKTAAQN HHHHHHHHHHHHHHH | 22.40 | 22461510 | |
53 | O-linked_Glycosylation | SYWESAKTAAQNLYE HHHHHHHHHHHHHHH | 27.26 | OGP | |
60 | Sulfoxidation | TAAQNLYEKTYLPAV HHHHHHHHHHHHHHH | 41.93 | 18729385 | |
75 | Phosphorylation | DEKLRDLYSKSTAAM HHHHHHHHCHHHCHH | 20.52 | 23532336 | |
86 | Phosphorylation | TAAMSTYTGIFTDQV HCHHHHHHCCCHHHH | 24.72 | 23532336 | |
86 | O-linked_Glycosylation | TAAMSTYTGIFTDQV HCHHHHHHCCCHHHH | 24.72 | OGP | |
98 | Ubiquitination | DQVLSVLKGEE---- HHHHHHHCCCC---- | 63.22 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APOC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APOC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APOC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LIPL_BOVIN | LPL | physical | 10727238 | |
CRYAB_HUMAN | CRYAB | physical | 23159935 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
207750 | Hyperlipoproteinemia 1B (HLPP1B) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...