| UniProt ID | AP1S1_HUMAN | |
|---|---|---|
| UniProt AC | P61966 | |
| Protein Name | AP-1 complex subunit sigma-1A | |
| Gene Name | AP1S1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 158 | |
| Subcellular Localization |
Golgi apparatus . Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side . Membrane, clathrin-coated pit . Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. |
|
| Protein Description | Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.. | |
| Protein Sequence | MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 (in isoform 2) | Ubiquitination | - | 42.26 | 21906983 | |
| 18 (in isoform 1) | Ubiquitination | - | 42.26 | 21906983 | |
| 18 | Ubiquitination | QGKLRLQKWYLATSD CCCHHHEEEEECCCH | 42.26 | 21906983 | |
| 20 | Phosphorylation | KLRLQKWYLATSDKE CHHHEEEEECCCHHH | 8.09 | 26074081 | |
| 23 | Phosphorylation | LQKWYLATSDKERKK HEEEEECCCHHHHHH | 34.56 | 26074081 | |
| 24 | Phosphorylation | QKWYLATSDKERKKM EEEEECCCHHHHHHH | 40.87 | 26074081 | |
| 26 | Ubiquitination | WYLATSDKERKKMVR EEECCCHHHHHHHHH | 60.22 | 21906983 | |
| 26 (in isoform 2) | Ubiquitination | - | 60.22 | 21906983 | |
| 26 (in isoform 1) | Ubiquitination | - | 60.22 | 21906983 | |
| 26 | Acetylation | WYLATSDKERKKMVR EEECCCHHHHHHHHH | 60.22 | 25953088 | |
| 26 | 2-Hydroxyisobutyrylation | WYLATSDKERKKMVR EEECCCHHHHHHHHH | 60.22 | - | |
| 36 | Sulfoxidation | KKMVRELMQVVLARK HHHHHHHHHHHHHCC | 2.14 | 30846556 | |
| 56 (in isoform 1) | Ubiquitination | - | 33.66 | 21906983 | |
| 56 | Ubiquitination | FLEWRDLKVVYKRYA CCCCCCHHHHHHHHH | 33.66 | 21906983 | |
| 56 (in isoform 2) | Ubiquitination | - | 33.66 | 21906983 | |
| 87 | Phosphorylation | TLELIHRYVELLDKY HHHHHHHHHHHHHHH | 5.54 | 11169837 | |
| 94 | Phosphorylation | YVELLDKYFGSVCEL HHHHHHHHCCCCEEE | 16.91 | 11169829 | |
| 128 | Ubiquitination | GDVQDTSKKSVLKAI CCCCCCCHHHHHHHH | 51.68 | 21906983 | |
| 128 (in isoform 1) | Ubiquitination | - | 51.68 | 21906983 | |
| 133 | Ubiquitination | TSKKSVLKAIEQADL CCHHHHHHHHHHHHH | 45.20 | 2190698 | |
| 133 | Acetylation | TSKKSVLKAIEQADL CCHHHHHHHHHHHHH | 45.20 | 25953088 | |
| 133 (in isoform 1) | Ubiquitination | - | 45.20 | 21906983 | |
| 147 | Phosphorylation | LLQEEDESPRSVLEE HHCCCCCCHHHHHHH | 37.62 | 30266825 | |
| 150 | Phosphorylation | EEDESPRSVLEEMGL CCCCCHHHHHHHCCC | 34.14 | 24076635 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP1S1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP1S1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP1S1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AP1G2_HUMAN | AP1G2 | physical | 9733768 | |
| AP1G1_HUMAN | AP1G1 | physical | 9733768 | |
| RAB10_HUMAN | RAB10 | physical | 17353931 | |
| S61A1_HUMAN | SEC61A1 | physical | 17353931 | |
| ARMC6_HUMAN | ARMC6 | physical | 17353931 | |
| EBLN2_HUMAN | EBLN2 | physical | 17353931 | |
| MOT1_HUMAN | SLC16A1 | physical | 17353931 | |
| AP1G1_HUMAN | AP1G1 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 609313 | Mental retardation, enteropathy, deafness, peripheral neuropathy, ichthyosis, and keratoderma (MEDNIK) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-147, AND MASSSPECTROMETRY. | |
| "Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-147, AND MASSSPECTROMETRY. | |
