UniProt ID | ANXB9_DROME | |
---|---|---|
UniProt AC | P22464 | |
Protein Name | Annexin B9 | |
Gene Name | AnxB9 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 324 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSSAEYYPFKCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCCKSKIDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKEDAETDIGYVLVTLTAW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MSSAEYYPFK -----CCCCCCCCCC | 24.66 | 27794539 | |
6 | Phosphorylation | --MSSAEYYPFKCTP --CCCCCCCCCCCCC | 19.02 | 19429919 | |
7 | Phosphorylation | -MSSAEYYPFKCTPT -CCCCCCCCCCCCCC | 8.16 | 19429919 | |
69 | Acetylation | AFKTSYGKDLISDLK HHHHHHCHHHHHHHH | 40.92 | 21791702 | |
69 | Acetylation | AFKTSYGKDLISDLK HHHHHHCHHHHHHHH | 40.92 | - | |
223 | Phosphorylation | FLEYENLSGNDIEKA HHHHHCCCCCHHHHH | 47.32 | 22668510 | |
253 | Acetylation | IVKCCKSKIDYFSER HHHHHHHHCHHHHHH | 25.70 | 21791702 | |
253 | Acetylation | IVKCCKSKIDYFSER HHHHHHHHCHHHHHH | 25.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANXB9_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANXB9_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANXB9_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UCHL_DROME | Uch | physical | 22036573 | |
SH3BG_DROME | Sh3beta | physical | 22036573 | |
ANX10_DROME | AnxB10 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...