UniProt ID | ANR49_HUMAN | |
---|---|---|
UniProt AC | Q8WVL7 | |
Protein Name | Ankyrin repeat domain-containing protein 49 | |
Gene Name | ANKRD49 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 239 | |
Subcellular Localization | Nucleus . | |
Protein Description | Induces HBG1 expression. [PubMed: 16131492] | |
Protein Sequence | MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | QSLWVGNSDEDEEQD CEEECCCCCCCHHCC | 36.13 | 26074081 | |
63 | Phosphorylation | DDKNEEWYRLQEKKM CHHCHHHHHHHHHHC | 12.53 | 26074081 | |
95 | Phosphorylation | TTVRRLLSEKATHVN HHHHHHHHHHCCCCC | 41.46 | 24719451 | |
99 | Phosphorylation | RLLSEKATHVNTRDE HHHHHHCCCCCCCCC | 37.11 | 11728097 | |
103 | Phosphorylation | EKATHVNTRDEDEYT HHCCCCCCCCCCCCC | 38.11 | 11728107 | |
199 | Phosphorylation | ELLLMNRYVKPGLKN HHHHHHHCCCCCCCC | 14.07 | 25884760 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANR49_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANR49_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANR49_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FKBPL_HUMAN | FKBPL | physical | 26627737 | |
FKBPL_HUMAN | FKBPL | physical | 28514442 | |
HIF1N_HUMAN | HIF1AN | physical | 28514442 | |
KC1E_HUMAN | CSNK1E | physical | 28514442 | |
CPNE4_HUMAN | CPNE4 | physical | 28514442 | |
RCBT2_HUMAN | RCBTB2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...