dbPTM

ANR49_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ANR49_HUMAN
UniProt AC	Q8WVL7
Protein Name	Ankyrin repeat domain-containing protein 49
Gene Name	ANKRD49
Organism	Homo sapiens (Human).
Sequence Length	239
Subcellular Localization	Nucleus .
Protein Description	Induces HBG1 expression. [PubMed: 16131492]
Protein Sequence	MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	QSLWVGNSDEDEEQD CEEECCCCCCCHHCC	36.13	26074081
63	Phosphorylation	DDKNEEWYRLQEKKM CHHCHHHHHHHHHHC	12.53	26074081
95	Phosphorylation	TTVRRLLSEKATHVN HHHHHHHHHHCCCCC	41.46	24719451
99	Phosphorylation	RLLSEKATHVNTRDE HHHHHHCCCCCCCCC	37.11	11728097
103	Phosphorylation	EKATHVNTRDEDEYT HHCCCCCCCCCCCCC	38.11	11728107
199	Phosphorylation	ELLLMNRYVKPGLKN HHHHHHHCCCCCCCC	14.07	25884760

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ANR49_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ANR49_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ANR49_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FKBPL_HUMAN	FKBPL	physical	26627737
FKBPL_HUMAN	FKBPL	physical	28514442
HIF1N_HUMAN	HIF1AN	physical	28514442
KC1E_HUMAN	CSNK1E	physical	28514442
CPNE4_HUMAN	CPNE4	physical	28514442
RCBT2_HUMAN	RCBTB2	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ANR49_HUMAN

Related Literatures of Post-Translational Modification