ANKR2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ANKR2_HUMAN
• UniProt AC: Q9GZV1
• Protein Name: Ankyrin repeat domain-containing protein 2
• Gene Name: ANKRD2
• Organism: Homo sapiens (Human).
• Sequence Length: 360
• Subcellular Localization: Cytoplasm, myofibril, sarcomere, I band. Cytoplasm, cytosol. Nucleus. Nucleus, PML body. In the sarcoplasm of differentiated striated muscle cells, where it is cytosolic and enriched in the I band. In nucleus and PML bodies of proliferating and undif
• Protein Description: Functions as a negative regulator of myocyte differentiation. May interact with both sarcoplasmic structural proteins and nuclear proteins to regulate gene expression during muscle development and in response to muscle stress..
• Protein Sequence: MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
83	Phosphorylation	EKHHGAQSAALQKVK CCCCCHHHHHHHHHH	18.25	26437602
98	Phosphorylation	GQERVRKTSLDLRRE CCHHHHHHCHHHHHH	24.77	30266825
99	Phosphorylation	QERVRKTSLDLRREI CHHHHHHCHHHHHHH	23.95	30266825
349	Phosphorylation	GLEGPNDSGRETPQP CCCCCCCCCCCCCCC	46.52	29116813
353	Phosphorylation	PNDSGRETPQPVPAQ CCCCCCCCCCCCCCC	26.34	29116813

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
99	S	Phosphorylation	Kinase	AKT2	P31751	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
99	S	Oxidation	Phosphorylation at Ser-99 by PKB/AKT2 in response to oxidative stress induces translocation to the nucleus and negatively regulates myoblast differentiation.	21737686
99	S	Phosphorylation	Phosphorylation at Ser-99 by PKB/AKT2 in response to oxidative stress induces translocation to the nucleus and negatively regulates myoblast differentiation.	21737686

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ANKR2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TELT_HUMAN	TCAP	physical	15136035
YBOX1_HUMAN	YBX1	physical	15136035
HBP1_HUMAN	HBP1	physical	20211142
ZBTB3_HUMAN	ZBTB3	physical	20211142

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.