UniProt ID | ANKR2_HUMAN | |
---|---|---|
UniProt AC | Q9GZV1 | |
Protein Name | Ankyrin repeat domain-containing protein 2 | |
Gene Name | ANKRD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 360 | |
Subcellular Localization | Cytoplasm, myofibril, sarcomere, I band. Cytoplasm, cytosol. Nucleus. Nucleus, PML body. In the sarcoplasm of differentiated striated muscle cells, where it is cytosolic and enriched in the I band. In nucleus and PML bodies of proliferating and undif | |
Protein Description | Functions as a negative regulator of myocyte differentiation. May interact with both sarcoplasmic structural proteins and nuclear proteins to regulate gene expression during muscle development and in response to muscle stress.. | |
Protein Sequence | MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
83 | Phosphorylation | EKHHGAQSAALQKVK CCCCCHHHHHHHHHH | 18.25 | 26437602 | |
98 | Phosphorylation | GQERVRKTSLDLRRE CCHHHHHHCHHHHHH | 24.77 | 30266825 | |
99 | Phosphorylation | QERVRKTSLDLRREI CHHHHHHCHHHHHHH | 23.95 | 30266825 | |
349 | Phosphorylation | GLEGPNDSGRETPQP CCCCCCCCCCCCCCC | 46.52 | 29116813 | |
353 | Phosphorylation | PNDSGRETPQPVPAQ CCCCCCCCCCCCCCC | 26.34 | 29116813 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
99 | S | Phosphorylation | Kinase | AKT2 | P31751 | Uniprot |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANKR2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TELT_HUMAN | TCAP | physical | 15136035 | |
YBOX1_HUMAN | YBX1 | physical | 15136035 | |
HBP1_HUMAN | HBP1 | physical | 20211142 | |
ZBTB3_HUMAN | ZBTB3 | physical | 20211142 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...