UniProt ID | ANGP2_HUMAN | |
---|---|---|
UniProt AC | O15123 | |
Protein Name | Angiopoietin-2 | |
Gene Name | ANGPT2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 496 | |
Subcellular Localization | Secreted. | |
Protein Description | Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.. | |
Protein Sequence | MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | AYNNFRKSMDSIGKK HHHHHHHHHHHHCCC | 24.46 | 23403867 | |
28 | Phosphorylation | NFRKSMDSIGKKQYQ HHHHHHHHHCCCEEE | 25.30 | 23403867 | |
89 | N-linked_Glycosylation | VLENIMENNTQWLMK HHHHHHHCCHHHHHH | 39.20 | UniProtKB CARBOHYD | |
119 | N-linked_Glycosylation | IQQNAVQNQTAVMIE HHHHHHHCCCEEEEE | 34.27 | UniProtKB CARBOHYD | |
133 | N-linked_Glycosylation | EIGTNLLNQTAEQTR EEHHHHHHHHHHHHH | 40.08 | UniProtKB CARBOHYD | |
151 | N-linked_Glycosylation | DVEAQVLNQTTRLEL HHHHHHHCCCCHHHH | 37.99 | UniProtKB CARBOHYD | |
208 | Phosphorylation | KHIIQLQSIKEEKDQ HHEEEEHHHHHHHHH | 44.19 | 166220839 | |
236 | Phosphorylation | ELEKKIVTATVNNSV HHHHHHHHHHCCHHH | 21.78 | 23532336 | |
240 | N-linked_Glycosylation | KIVTATVNNSVLQKQ HHHHHHCCHHHHHHH | 30.61 | UniProtKB CARBOHYD | |
242 | Phosphorylation | VTATVNNSVLQKQQH HHHHCCHHHHHHHHH | 20.99 | 69101583 | |
294 | Phosphorylation | VFKSGHTTNGIYTLT HHHCCCCCCEEEEEE | 26.27 | 25003641 | |
299 | Phosphorylation | HTTNGIYTLTFPNST CCCCEEEEEECCCCH | 19.87 | 25003641 | |
304 | N-linked_Glycosylation | IYTLTFPNSTEEIKA EEEEECCCCHHHHHH | 58.32 | UniProtKB CARBOHYD | |
359 | Ubiquitination | EYWLGNEFVSQLTNQ CEEECHHHHHHHHHC | 8.11 | 21963094 | |
360 | Ubiquitination | YWLGNEFVSQLTNQQ EEECHHHHHHHHHCC | 2.65 | 21963094 | |
411 | Ubiquitination | KGLTGTAGKISSISQ ECCCCCCCCCCCCCC | 27.89 | 21963094 | |
412 | Ubiquitination | GLTGTAGKISSISQP CCCCCCCCCCCCCCC | 36.63 | 21963094 | |
482 | Phosphorylation | YYWKGSGYSLKATTM EEECCCCCCCEEEEE | 16.72 | 2033135 | |
483 | Phosphorylation | YWKGSGYSLKATTMM EECCCCCCCEEEEEE | 27.24 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANGP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ANGP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANGP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TIE2_HUMAN | TEK | physical | 25237190 | |
ITB1_HUMAN | ITGB1 | physical | 25237190 | |
ITA5_HUMAN | ITGA5 | physical | 25237190 | |
ITB1_HUMAN | ITGB1 | physical | 16424009 | |
ITA5_HUMAN | ITGA5 | physical | 16424009 | |
ITAV_HUMAN | ITGAV | physical | 16424009 | |
ZZEF1_HUMAN | ZZEF1 | physical | 28514442 | |
FBX28_HUMAN | FBXO28 | physical | 28514442 | |
HECD3_HUMAN | HECTD3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...