| UniProt ID | ANGL3_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5C1 | |
| Protein Name | Angiopoietin-related protein 3 | |
| Gene Name | ANGPTL3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 460 | |
| Subcellular Localization | Secreted . Cell projection, lamellipodium . Colocalized with HSPG2 and activated ITGB3 on podocytes. | |
| Protein Description | Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism. [PubMed: 11788823] | |
| Protein Sequence | MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | IVPLVISSRIDQDNS HHHHHHHCCCCCCCC | 23.33 | 24719451 | |
| 24 | Phosphorylation | SRIDQDNSSFDSLSP CCCCCCCCCCCCCCC | 40.44 | 24505115 | |
| 25 | Phosphorylation | RIDQDNSSFDSLSPE CCCCCCCCCCCCCCC | 39.05 | 19824718 | |
| 28 | Phosphorylation | QDNSSFDSLSPEPKS CCCCCCCCCCCCCCH | 28.83 | 24505115 | |
| 115 | N-linked_Glycosylation | VKNEEVKNMSLELNS ECCHHHHHCCHHHHH | 30.37 | 10644446 | |
| 122 | O-linked_Glycosylation | NMSLELNSKLESLLE HCCHHHHHHHHHHHH | 51.77 | 29351928 | |
| 126 | Phosphorylation | ELNSKLESLLEEKIL HHHHHHHHHHHHHHH | 49.00 | 24719451 | |
| 206 | Phosphorylation | IENQLRRTSIQEPTE HHHHHHHCCCCCCCC | 24.61 | 68700725 | |
| 206 | O-linked_Glycosylation | IENQLRRTSIQEPTE HHHHHHHCCCCCCCC | 24.61 | OGP | |
| 207 | Phosphorylation | ENQLRRTSIQEPTEI HHHHHHCCCCCCCCC | 22.06 | 68700731 | |
| 212 | O-linked_Glycosylation | RTSIQEPTEISLSSK HCCCCCCCCCCCCCC | 45.24 | OGP | |
| 215 | O-linked_Glycosylation | IQEPTEISLSSKPRA CCCCCCCCCCCCCCC | 18.90 | OGP | |
| 217 | O-linked_Glycosylation | EPTEISLSSKPRAPR CCCCCCCCCCCCCCC | 29.53 | OGP | |
| 218 | O-linked_Glycosylation | PTEISLSSKPRAPRT CCCCCCCCCCCCCCC | 52.55 | OGP | |
| 225 | O-linked_Glycosylation | SKPRAPRTTPFLQLN CCCCCCCCCCCCCHH | 37.45 | OGP | |
| 226 | O-linked_Glycosylation | KPRAPRTTPFLQLNE CCCCCCCCCCCCHHH | 17.21 | 20837471 | |
| 296 | N-linked_Glycosylation | IDGSQNFNETWENYK CCCCCCCCHHHHHHC | 54.03 | 16335952 | |
| 357 | N-linked_Glycosylation | YLGNHETNYTLHLVA EECCCCCCEEEEEEE | 25.47 | 16335952 | |
| 436 | Phosphorylation | RRGLSWKSQNGRLYS HCCCCEECCCCCEEE | 23.71 | 101546011 | |
| 442 | Phosphorylation | KSQNGRLYSIKSTKM ECCCCCEEEEEECEE | 13.64 | 22210691 | |
| 443 | Phosphorylation | SQNGRLYSIKSTKML CCCCCEEEEEECEEE | 28.29 | 24719451 | |
| 446 | Phosphorylation | GRLYSIKSTKMLIHP CCEEEEEECEEEECC | 31.43 | 24719451 | |
| 447 | Phosphorylation | RLYSIKSTKMLIHPT CEEEEEECEEEECCC | 18.57 | 24719451 | |
| 456 | Phosphorylation | MLIHPTDSESFE--- EEECCCCCCCCC--- | 37.30 | 24505115 | |
| 458 | Phosphorylation | IHPTDSESFE----- ECCCCCCCCC----- | 38.33 | 24505115 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ANGL3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 226 | T | Glycosylation |
| 20837471 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ANGL3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CCD91_HUMAN | CCDC91 | physical | 28514442 | |
| GULP1_HUMAN | GULP1 | physical | 28514442 | |
| FBX28_HUMAN | FBXO28 | physical | 28514442 | |
| BIRC6_HUMAN | BIRC6 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 605019 | Hypobetalipoproteinemia, familial, 2 (FHBL2) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-296, AND MASSSPECTROMETRY. | |
| "Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-115; ASN-296 AND ASN-357,AND MASS SPECTROMETRY. | |
| "Identification of a mammalian angiopoietin-related protein expressedspecifically in liver."; Conklin D., Gilbertson D., Taft D.W., Maurer M.F., Whitmore T.E.,Smith D.L., Walker K.M., Chen L.H., Wattler S., Nehls M., Lewis K.B.; Genomics 62:477-482(1999). Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY, AND GLYCOSYLATION ATASN-115. | |