UniProt ID | AIFM3_HUMAN | |
---|---|---|
UniProt AC | Q96NN9 | |
Protein Name | Apoptosis-inducing factor 3 | |
Gene Name | AIFM3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 605 | |
Subcellular Localization | Mitochondrion . Does not translocate to the nucleus upon induction of apoptosis. | |
Protein Description | Induces apoptosis through a caspase dependent pathway. Reduces mitochondrial membrane potential.. | |
Protein Sequence | MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWLTGKGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MGGCFSKPKPVEL --CCCCCCCCCCEEE | 52.72 | 24719451 | |
36 | Phosphorylation | LSASGKGSPRAYQGN CCCCCCCCCCCCCCC | 18.07 | 31437759 | |
45 | Phosphorylation | RAYQGNGTARHFHTE CCCCCCCCCCCCCCC | 25.23 | 68743731 | |
112 | Phosphorylation | LGHKCPHYGAPLVKG CCCCCCCCCCCCHHH | 10.50 | 23607784 | |
122 | Phosphorylation | PLVKGVLSRGRVRCP CCHHHHHHCCCEECC | 30.22 | 24719451 | |
290 | Phosphorylation | KDGFKLEYSKLLLAP ECCEEEEEEEEEECC | 22.88 | 26074081 | |
291 | Phosphorylation | DGFKLEYSKLLLAPG CCEEEEEEEEEECCC | 13.88 | 26074081 | |
299 | Phosphorylation | KLLLAPGSSPKTLSC EEEECCCCCCCCEEC | 42.27 | 26074081 | |
300 | Phosphorylation | LLLAPGSSPKTLSCK EEECCCCCCCCEECC | 36.01 | 26074081 | |
303 | Phosphorylation | APGSSPKTLSCKGKE CCCCCCCCEECCCEE | 27.56 | 26074081 | |
305 | Phosphorylation | GSSPKTLSCKGKEVE CCCCCCEECCCEEEE | 21.00 | 26074081 | |
316 | Phosphorylation | KEVENVFTIRTPEDA EEEEEEEEECCHHHH | 12.79 | 26074081 | |
352 | Phosphorylation | MEVAAYLTEKAHSVS HHHHHHHHHCCCCCE | 23.82 | 22210691 | |
357 | Phosphorylation | YLTEKAHSVSVVELE HHHHCCCCCEEEECC | 22.43 | 22210691 | |
366 | Phosphorylation | SVVELEETPFRRFLG EEEECCCCCHHHHHH | 20.53 | 22210691 | |
392 | Phosphorylation | ENNRVKFYMQTEVSE HCCCEEEEEEHHHHH | 5.21 | 30624053 | |
395 | Phosphorylation | RVKFYMQTEVSELRG CEEEEEEHHHHHHCC | 23.09 | 30624053 | |
398 | Phosphorylation | FYMQTEVSELRGQEG EEEEHHHHHHCCCCC | 25.36 | 26270265 | |
415 | Phosphorylation | KEVVLKSSKVVRADV EEHHHHCCCCCCCCE | 28.07 | 46160951 | |
433 | Phosphorylation | GIGAVPATGFLRQSG CCCCCCCCCHHHHCC | 23.54 | 68710083 | |
439 | Phosphorylation | ATGFLRQSGIGLDSR CCCHHHHCCCCCCCC | 26.41 | 68710085 | |
445 | Phosphorylation | QSGIGLDSRGFIPVN HCCCCCCCCCCEEHH | 39.07 | 68710087 | |
470 | Phosphorylation | FAAGDAVTFPLAWRN EECCCEEEECEEECC | 22.66 | 46160963 | |
587 (in isoform 3) | Phosphorylation | - | 4.31 | - | |
593 (in isoform 2) | Phosphorylation | - | 45.86 | - | |
605 | Phosphorylation | SWLTGKGS------- HHHCCCCC------- | 40.30 | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIFM3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIFM3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIFM3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
FPPS_HUMAN | FDPS | physical | 26344197 | |
PPIF_HUMAN | PPIF | physical | 26344197 | |
NMT2_HUMAN | NMT2 | physical | 28514442 | |
NMT1_HUMAN | NMT1 | physical | 28514442 | |
PGK2_HUMAN | PGK2 | physical | 28514442 | |
LZTR1_HUMAN | LZTR1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...