UniProt ID | AIF1L_MOUSE | |
---|---|---|
UniProt AC | Q9EQX4 | |
Protein Name | Allograft inflammatory factor 1-like | |
Gene Name | Aif1l | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 150 | |
Subcellular Localization |
Cytoplasm, cytoskeleton. Cell projection, ruffle membrane Peripheral membrane protein Cytoplasmic side. Colocalizes with F-actin. Partially relocates to membrane ruffles in response to invading bacteria (By similarity).. |
|
Protein Description | Actin-binding protein that promotes actin bundling. May neither bind calcium nor depend on calcium for function (By similarity).. | |
Protein Sequence | MSVALSNRFQGGKAFGLLKARQEKRLEEINREFLCDQKYSDEENLPEKLAAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPAGPPPERDIASLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSVALSNRF ------CCCCCCCCC | 18.98 | - | |
2 | Phosphorylation | ------MSVALSNRF ------CCCCCCCCC | 18.98 | 29514104 | |
13 | Acetylation | SNRFQGGKAFGLLKA CCCCCCCHHHHHHHH | 47.57 | - | |
13 | Ubiquitination | SNRFQGGKAFGLLKA CCCCCCCHHHHHHHH | 47.57 | - | |
133 | Phosphorylation | FEGKANESSPKPAGP HHCCCCCCCCCCCCC | 52.31 | 26239621 | |
134 | Phosphorylation | EGKANESSPKPAGPP HCCCCCCCCCCCCCC | 30.66 | 26239621 | |
148 | Phosphorylation | PPERDIASLP----- CCCCCCCCCC----- | 41.32 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIF1L_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIF1L_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIF1L_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TR150_HUMAN | THRAP3 | physical | 20360068 | |
AIF1L_HUMAN | AIF1L | physical | 20360068 | |
PCBP2_HUMAN | PCBP2 | physical | 20360068 | |
PCBP1_HUMAN | PCBP1 | physical | 20360068 | |
PCBP3_HUMAN | PCBP3 | physical | 20360068 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...