AFP3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AFP3_ARATH
• UniProt AC: Q94F39
• Protein Name: Ninja-family protein AFP3
• Gene Name: AFP3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 231
• Subcellular Localization: Nucleus.
• Protein Description: Acts as a negative regulator of abscisic acid (ABA) response and stress responses..
• Protein Sequence: MSKKQRLSEEDGEVEIELDLGLSLNGRFGVDPLAKTRLMRSTSVLDLVVNDRSGLSRTCSLPVETEEEWRKRKELQSLRRLEAKRKRSEKQRKHKACGGEEKVVEEGSIGSSGSGSSGLSEVDTLLPPVQATTNKSVETSPSSAQSQPENLGKEASQNIIEDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	AKTRLMRSTSVLDLV HHHHCCCCCCEEEEE	15.86	29654922
42	Phosphorylation	KTRLMRSTSVLDLVV HHHCCCCCCEEEEEE	16.70	29654922
43	Phosphorylation	TRLMRSTSVLDLVVN HHCCCCCCEEEEEEC	23.17	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AFP3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AFP3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AFP3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AI5L2_ARATH	AREB3	physical	21798944
CYC2_ARATH	CYTC-2	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.