UniProt ID | AFP3_ARATH | |
---|---|---|
UniProt AC | Q94F39 | |
Protein Name | Ninja-family protein AFP3 | |
Gene Name | AFP3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 231 | |
Subcellular Localization | Nucleus. | |
Protein Description | Acts as a negative regulator of abscisic acid (ABA) response and stress responses.. | |
Protein Sequence | MSKKQRLSEEDGEVEIELDLGLSLNGRFGVDPLAKTRLMRSTSVLDLVVNDRSGLSRTCSLPVETEEEWRKRKELQSLRRLEAKRKRSEKQRKHKACGGEEKVVEEGSIGSSGSGSSGLSEVDTLLPPVQATTNKSVETSPSSAQSQPENLGKEASQNIIEDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | AKTRLMRSTSVLDLV HHHHCCCCCCEEEEE | 15.86 | 29654922 | |
42 | Phosphorylation | KTRLMRSTSVLDLVV HHHCCCCCCEEEEEE | 16.70 | 29654922 | |
43 | Phosphorylation | TRLMRSTSVLDLVVN HHCCCCCCEEEEEEC | 23.17 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AFP3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AFP3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AFP3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AI5L2_ARATH | AREB3 | physical | 21798944 | |
CYC2_ARATH | CYTC-2 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...