| UniProt ID | AFP3_ARATH | |
|---|---|---|
| UniProt AC | Q94F39 | |
| Protein Name | Ninja-family protein AFP3 | |
| Gene Name | AFP3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 231 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Acts as a negative regulator of abscisic acid (ABA) response and stress responses.. | |
| Protein Sequence | MSKKQRLSEEDGEVEIELDLGLSLNGRFGVDPLAKTRLMRSTSVLDLVVNDRSGLSRTCSLPVETEEEWRKRKELQSLRRLEAKRKRSEKQRKHKACGGEEKVVEEGSIGSSGSGSSGLSEVDTLLPPVQATTNKSVETSPSSAQSQPENLGKEASQNIIEDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 41 | Phosphorylation | AKTRLMRSTSVLDLV HHHHCCCCCCEEEEE | 15.86 | 29654922 | |
| 42 | Phosphorylation | KTRLMRSTSVLDLVV HHHCCCCCCEEEEEE | 16.70 | 29654922 | |
| 43 | Phosphorylation | TRLMRSTSVLDLVVN HHCCCCCCEEEEEEC | 23.17 | 30291188 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AFP3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AFP3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AFP3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AI5L2_ARATH | AREB3 | physical | 21798944 | |
| CYC2_ARATH | CYTC-2 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...