UniProt ID | ADAT2_HUMAN | |
---|---|---|
UniProt AC | Q7Z6V5 | |
Protein Name | tRNA-specific adenosine deaminase 2 | |
Gene Name | ADAT2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 191 | |
Subcellular Localization | ||
Protein Description | Probably participates in deamination of adenosine-34 to inosine in many tRNAs.. | |
Protein Sequence | MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Ubiquitination | SGACSVSAEETEKWM CCCCCCCHHHHHHHH | 19.25 | 24816145 | |
66 | Ubiquitination | RNEVNQTKNATRHAE HHHHHCCCHHHHHHH | 34.52 | 24816145 | |
105 | Ubiquitination | TVLYVTVEPCIMCAA EEEEEEHHHHHHHHH | 25.70 | 24816145 | |
125 | Ubiquitination | KIPLVVYGCQNERFG CCCEEEEECCCCCCC | 8.57 | 29967540 | |
166 | Sulfoxidation | RAEEAVEMLKTFYKQ CHHHHHHHHHHHHHH | 3.60 | 21406390 | |
172 | Ubiquitination | EMLKTFYKQENPNAP HHHHHHHHHHCCCCC | 47.12 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADAT2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADAT2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADAT2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
ADAT3_HUMAN | ADAT3 | physical | 26186194 | |
ADAT3_HUMAN | ADAT3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...