ADAT2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADAT2_HUMAN
• UniProt AC: Q7Z6V5
• Protein Name: tRNA-specific adenosine deaminase 2
• Gene Name: ADAT2
• Organism: Homo sapiens (Human).
• Sequence Length: 191
• Protein Description: Probably participates in deamination of adenosine-34 to inosine in many tRNAs..
• Protein Sequence: MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Ubiquitination	SGACSVSAEETEKWM CCCCCCCHHHHHHHH	19.25	24816145
66	Ubiquitination	RNEVNQTKNATRHAE HHHHHCCCHHHHHHH	34.52	24816145
105	Ubiquitination	TVLYVTVEPCIMCAA EEEEEEHHHHHHHHH	25.70	24816145
125	Ubiquitination	KIPLVVYGCQNERFG CCCEEEEECCCCCCC	8.57	29967540
166	Sulfoxidation	RAEEAVEMLKTFYKQ CHHHHHHHHHHHHHH	3.60	21406390
172	Ubiquitination	EMLKTFYKQENPNAP HHHHHHHHHHCCCCC	47.12	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ADAT2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ADAT2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADAT2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
ADAT3_HUMAN	ADAT3	physical	26186194
ADAT3_HUMAN	ADAT3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.