dbPTM

ACY2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ACY2_HUMAN
UniProt AC	P45381
Protein Name	Aspartoacylase
Gene Name	ASPA
Organism	Homo sapiens (Human).
Sequence Length	313
Subcellular Localization	Cytoplasm. Nucleus.
Protein Description	Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it act as a scavenger of NAA from body fluids..
Protein Sequence	MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTSCHIAEE ------CCCCCCCHH	39.81	28857561
3	Phosphorylation	-----MTSCHIAEEH -----CCCCCCCHHH	11.47	28857561
64	Phosphorylation	AVKKCTRYIDCDLNR HHHHCCCEECCCHHH	5.29	-
83	Phosphorylation	ENLGKKMSEDLPYEV HHHHHHHHCCCCHHH	36.52	22817900
88	Phosphorylation	KMSEDLPYEVRRAQE HHHCCCCHHHHHHHH	34.06	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ACY2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ACY2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ACY2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACY2_HUMAN	ASPA	physical	16189514
ACY3_HUMAN	ACY3	physical	25416956
RUFY1_HUMAN	RUFY1	physical	28514442
PGK2_HUMAN	PGK2	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
271900	Canavan disease (CAND)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB00128	L-Aspartic Acid

Regulatory Network of ACY2_HUMAN

Related Literatures of Post-Translational Modification