UniProt ID | ABT1_MOUSE | |
---|---|---|
UniProt AC | Q9QYL7 | |
Protein Name | Activator of basal transcription 1 | |
Gene Name | Abt1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 269 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . | |
Protein Description | Could be a novel TATA-binding protein (TBP) which can function as a basal transcription activator. Can act as a regulator of basal transcription for class II genes.. | |
Protein Sequence | MVKAGELVEQQKAAMEEEANAEAAEDQEEPEDTACSSSSKKKKKVVPGIVYLGHVPPRFRPLHVRNLLSAYGEVGRVFFQAEDHFVKRKKKAAAAAGGKKGAKYSKDYTEGWVEFRDKRVAKRVAASLHNTPMGARKRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTEQEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
91 | Acetylation | HFVKRKKKAAAAAGG HHHHHHHHHHHHCCC | 46.42 | 7304775 | |
99 | Acetylation | AAAAAGGKKGAKYSK HHHHCCCCCCCCCCC | 47.30 | 7921113 | |
100 | Acetylation | AAAAGGKKGAKYSKD HHHCCCCCCCCCCCC | 68.33 | 7708575 | |
103 | Acetylation | AGGKKGAKYSKDYTE CCCCCCCCCCCCCCC | 59.74 | 19845177 | |
106 | Acetylation | KKGAKYSKDYTEGWV CCCCCCCCCCCCCCE | 52.22 | 19845185 | |
139 | Phosphorylation | PMGARKRSPFRYDLW CCCCCCCCCCCHHCC | 31.27 | 46157321 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABT1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABT1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABT1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...