ABHD5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ABHD5_MOUSE
• UniProt AC: Q9DBL9
• Protein Name: 1-acylglycerol-3-phosphate O-acyltransferase ABHD5
• Gene Name: Abhd5
• Organism: Mus musculus (Mouse).
• Sequence Length: 351
• Subcellular Localization: Cytoplasm. Lipid droplet. Colocalized with PLIN and ADRP on the surface of lipid droplets. The localization is dependent upon the metabolic status of the adipocytes and the activity of PKA.
• Protein Description: Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. [PubMed: 16679289 May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2]
• Protein Sequence: MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	S-palmitoylation	KMLKCVPCTYKKEPV HHHCCEECCCCCCCE	3.03	28680068
117	Phosphorylation	DLLGFGRSSRPRFDS HHCCCCCCCCCCCCC	30.95	19854140
118	Phosphorylation	LLGFGRSSRPRFDSD HCCCCCCCCCCCCCC	44.97	19854140
124	Phosphorylation	SSRPRFDSDAEEVEN CCCCCCCCCHHHHHH	35.69	27180971
239	Phosphorylation	PDFKRKYSSMFEDDT HHHHHHHHHHCCCCC	20.54	73488799
316	Ubiquitination	SIQSLRPKSYVKTIA CHHHCCCHHHEEEEE	48.24	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
239	S	Phosphorylation	Kinase	PKACA	P17612	PSP
239	S	Phosphorylation	Kinase	PKACA	P05132	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ABHD5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ABHD5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PLIN1_MOUSE	Plin1	physical	15136565
PLIN2_MOUSE	Plin2	physical	15136565
PLPL2_MOUSE	Pnpla2	physical	16679289
PLIN1_MOUSE	Plin1	physical	16679289
PLPL2_MOUSE	Pnpla2	physical	21393244
PLIN1_MOUSE	Plin1	physical	21393244
PLPL2_HUMAN	PNPLA2	physical	18445597

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.