| UniProt ID | AAMDC_HUMAN | |
|---|---|---|
| UniProt AC | Q9H7C9 | |
| Protein Name | Mth938 domain-containing protein | |
| Gene Name | AAMDC | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 122 | |
| Subcellular Localization | Cytoplasm. Diffuse distribution with some highly concentrated spots around the nucleus.. | |
| Protein Description | May play a role in preadipocyte differentiation and adipogenesis.. | |
| Protein Sequence | MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTSPEIASL ------CCCHHHHHC | 20068231 | ||
| 3 | Phosphorylation | -----MTSPEIASLS -----CCCHHHHHCC | 30576142 | ||
| 8 | Phosphorylation | MTSPEIASLSWGQMK CCCHHHHHCCCCCEE | 30576142 | ||
| 10 | Phosphorylation | SPEIASLSWGQMKVK CHHHHHCCCCCEEEE | 21406692 | ||
| 19 | Phosphorylation | GQMKVKGSNTTYKDC CCEEEECCCCCCCCC | 30576142 | ||
| 27 | Ubiquitination | NTTYKDCKVWPGGSR CCCCCCCEEECCCCC | - | ||
| 33 | Phosphorylation | CKVWPGGSRTWDWRE CEEECCCCCCEECHH | 28348404 | ||
| 35 | Phosphorylation | VWPGGSRTWDWRETG EECCCCCCEECHHCC | 23403867 | ||
| 41 | Phosphorylation | RTWDWRETGTEHSPG CCEECHHCCCCCCCC | 29255136 | ||
| 43 | Phosphorylation | WDWRETGTEHSPGVQ EECHHCCCCCCCCCC | 29255136 | ||
| 46 | Phosphorylation | RETGTEHSPGVQPAD HHCCCCCCCCCCCCH | 29255136 | ||
| 55 | Ubiquitination | GVQPADVKEVVEKGV CCCCCHHHHHHHCCC | - | ||
| 64 | Phosphorylation | VVEKGVQTLVIGRGM HHHCCCCEEEECCCH | 21406692 | ||
| 69 | Methylation | VQTLVIGRGMSEALK CCEEEECCCHHHHHC | - | ||
| 86 | 2-Hydroxyisobutyrylation | SSTVEYLKKHGIDVR HHHHHHHHHCCCCEE | - | ||
| 93 | Methylation | KKHGIDVRVLQTEQA HHCCCCEEEEEHHHH | - | ||
| 120 | Phosphorylation | RVGGVFHSTC----- EECCEEECCC----- | 27251275 | ||
| 121 | Phosphorylation | VGGVFHSTC------ ECCEEECCC------ | 113334017 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AAMDC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AAMDC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AAMDC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| ACY3_HUMAN | ACY3 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
