UniProt ID | ZNF70_HUMAN | |
---|---|---|
UniProt AC | Q9UC06 | |
Protein Name | Zinc finger protein 70 | |
Gene Name | ZNF70 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 446 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | AFENRLESQQGLFPG CCCCHHHHCCCCCCC | 32.18 | 24719451 | |
48 | Phosphorylation | LEQMAVIYKEIPLGE HHHHHHEEEECCCCC | 8.93 | 28152594 | |
109 | Phosphorylation | SMCQIIHSEEPSPCD CCEEEEECCCCCCCC | 32.99 | - | |
150 | Phosphorylation | RECGKAFSQSSHLLR HHHHHHHHHHHHHHH | 33.73 | 28555341 | |
152 | Phosphorylation | CGKAFSQSSHLLRHL HHHHHHHHHHHHHHH | 20.66 | - | |
153 | Phosphorylation | GKAFSQSSHLLRHLV HHHHHHHHHHHHHHH | 15.54 | - | |
163 | Phosphorylation | LRHLVIHTGEKPYEC HHHHHHCCCCCCCCC | 35.59 | 30576142 | |
178 | Phosphorylation | CECGKAFSQSSHLLR CCCCHHHHCCHHHHH | 33.73 | 28555341 | |
191 | Phosphorylation | LRHQIIHTGEKPYEC HHHCEEECCCCCCCH | 36.31 | 29214152 | |
208 | Phosphorylation | CGKAFRQSSALTQHQ HHHHHHHHCHHHHHH | 17.21 | 28555341 | |
212 | Phosphorylation | FRQSSALTQHQKIHT HHHHCHHHHHHHHHC | 24.58 | 29083192 | |
219 | Phosphorylation | TQHQKIHTGKRPYEC HHHHHHHCCCCCCCH | 48.12 | 29083192 | |
236 | Phosphorylation | CGKDFSRSSSLRKHE CCCCCCCCHHHCCCC | 24.07 | - | |
247 | Phosphorylation | RKHERIHTGERPYQC CCCCCCCCCCCCCCH | 38.06 | 27732954 | |
328 | Ubiquitination | SNLIEHRKTHTGEKP CCHHHHCCCCCCCCC | 46.71 | - | |
329 | Phosphorylation | NLIEHRKTHTGEKPY CHHHHCCCCCCCCCC | 25.32 | 28348404 | |
331 | Phosphorylation | IEHRKTHTGEKPYKC HHHCCCCCCCCCCCC | 52.87 | 24719451 | |
334 | Ubiquitination | RKTHTGEKPYKCQKC CCCCCCCCCCCCCCC | 55.80 | - | |
359 | Phosphorylation | IEHQRIHTGEKPYEC HHHCCCCCCCCCCCC | 44.67 | 28111955 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZNF70_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZNF70_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZNF70_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZF64A_HUMAN | ZFP64 | physical | 20211142 | |
ZF64B_HUMAN | ZFP64 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...