| UniProt ID | ZN778_HUMAN | |
|---|---|---|
| UniProt AC | Q96MU6 | |
| Protein Name | Zinc finger protein 778 | |
| Gene Name | ZNF778 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 729 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQDAVTFDDVAVDFTQEEWTLLDPSQRDLYRDVMLENYENLASVEWRLKTKGPALRQDRSWFRASNETQTARSHNGGQLCDRTQCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIPCQKTLFKIGEQFSVLGQCGKAFSSTPNVVSQQACTRDRSLDYSSCGEVFLNQSYLQARAGSHNGEETWKWKPCGKALTHSMGCATPVEMHAVRNPHVCRECGKAFRYTAYLTGRVQVHPGEKPCELEECGKASPVSSSLTQHVRIHAAEKPCECKECGKAFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFACVVCGKYFRNSSCLNNHVRIHTGIKPYTCSYCGKAFTVRCGLTRHVRTHTGEKPYTCKDCGKAFCTSSGLTEHVRTHTGEKPYECKDCGKSFTVSSSLTEHARIHTGEKPYECKQCGKAFTGRSGLTKHMRTHTGEKPYECKDCGKAYNRVYLLNEHVKTHTEEKPFICTVCRKSFRNSSCLNKHIQIHTGIKPYECKDCGKTFTVSSSLTEHIRTHTGEKPYECKVCGKAFTTSSHLIVHIRTHTGEKPYICKECGKAFASSSHLIEHRRTHTGEKPYICNECGKAFRASSHLHKHGRIHTGQKPYKCKECGKAYNRFYLLKEHLKTYTEEQVFVCKDCGKSFKNSSCLNHHTQIHTDEKPF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 144 | Phosphorylation | RTQNTGDSCVSNHYE EECCCCCCCCCCCCC | 20.12 | 25137130 | |
| 147 | Phosphorylation | NTGDSCVSNHYERDF CCCCCCCCCCCCCCC | 23.40 | 25137130 | |
| 290 | Phosphorylation | LEECGKASPVSSSLT CEECCCCCCCCCHHH | 29.35 | 25159151 | |
| 337 | Phosphorylation | TDPGQKPYECKDCGK CCCCCCCEECCCCCC | 40.78 | 18491316 | |
| 340 | Sumoylation | GQKPYECKDCGKACG CCCCEECCCCCCCCC | 44.08 | - | |
| 340 | Sumoylation | GQKPYECKDCGKACG CCCCEECCCCCCCCC | 44.08 | - | |
| 357 | Acetylation | YLLNEHGKTHTREKP EEECCCCCCCCCCCC | 38.75 | 7408803 | |
| 414 | Phosphorylation | GLTRHVRTHTGEKPY CCEEECCCCCCCCCE | 23.77 | - | |
| 416 | Phosphorylation | TRHVRTHTGEKPYTC EEECCCCCCCCCEEC | 46.56 | - | |
| 432 | Phosphorylation | DCGKAFCTSSGLTEH CCCCEEECCCCCCCC | 21.34 | 27251275 | |
| 433 | Phosphorylation | CGKAFCTSSGLTEHV CCCEEECCCCCCCCC | 24.48 | 27251275 | |
| 442 | Phosphorylation | GLTEHVRTHTGEKPY CCCCCCHHCCCCCCE | 23.77 | 29396449 | |
| 444 | Phosphorylation | TEHVRTHTGEKPYEC CCCCHHCCCCCCEEC | 46.56 | 29496963 | |
| 447 | Ubiquitination | VRTHTGEKPYECKDC CHHCCCCCCEECCCC | 55.00 | - | |
| 452 | Sumoylation | GEKPYECKDCGKSFT CCCCEECCCCCCEEE | 44.08 | - | |
| 452 | Sumoylation | GEKPYECKDCGKSFT CCCCEECCCCCCEEE | 44.08 | - | |
| 472 | Phosphorylation | TEHARIHTGEKPYEC HCCCEECCCCCCCCC | 44.67 | 29496963 | |
| 480 | Sumoylation | GEKPYECKQCGKAFT CCCCCCCCCCCCEEC | 36.36 | - | |
| 480 | Sumoylation | GEKPYECKQCGKAFT CCCCCCCCCCCCEEC | 36.36 | - | |
| 498 | Phosphorylation | GLTKHMRTHTGEKPY CCCCCCCCCCCCCCC | 19.06 | 29396449 | |
| 500 | Phosphorylation | TKHMRTHTGEKPYEC CCCCCCCCCCCCCCC | 46.56 | 29496963 | |
| 503 | Ubiquitination | MRTHTGEKPYECKDC CCCCCCCCCCCCCCH | 55.00 | - | |
| 508 | Sumoylation | GEKPYECKDCGKAYN CCCCCCCCCHHHHHH | 44.08 | - | |
| 508 | Sumoylation | GEKPYECKDCGKAYN CCCCCCCCCHHHHHH | 44.08 | - | |
| 526 | Phosphorylation | LLNEHVKTHTEEKPF ECCCHHCCCCCCCCE | 32.70 | - | |
| 528 | Phosphorylation | NEHVKTHTEEKPFIC CCHHCCCCCCCCEEE | 51.58 | - | |
| 536 | Phosphorylation | EEKPFICTVCRKSFR CCCCEEEEEECHHHC | 20.16 | - | |
| 564 | Sumoylation | GIKPYECKDCGKTFT CCCCEECCCCCCEEE | 44.08 | - | |
| 564 | Sumoylation | GIKPYECKDCGKTFT CCCCEECCCCCCEEE | 44.08 | - | |
| 582 | Phosphorylation | SLTEHIRTHTGEKPY HHHHHHHHCCCCCCE | 24.16 | 29396449 | |
| 584 | Phosphorylation | TEHIRTHTGEKPYEC HHHHHHCCCCCCEEC | 46.56 | 29496963 | |
| 587 | Ubiquitination | IRTHTGEKPYECKVC HHHCCCCCCEECEEC | 55.00 | - | |
| 610 | Phosphorylation | HLIVHIRTHTGEKPY EEEEEEEECCCCCCE | 24.16 | - | |
| 612 | Phosphorylation | IVHIRTHTGEKPYIC EEEEEECCCCCCEEE | 46.56 | 28674419 | |
| 615 | Sumoylation | IRTHTGEKPYICKEC EEECCCCCCEEEHHH | 44.45 | - | |
| 615 | Ubiquitination | IRTHTGEKPYICKEC EEECCCCCCEEEHHH | 44.45 | - | |
| 615 | Sumoylation | IRTHTGEKPYICKEC EEECCCCCCEEEHHH | 44.45 | - | |
| 620 | Ubiquitination | GEKPYICKECGKAFA CCCCEEEHHHHHHHH | 46.62 | - | |
| 638 | Phosphorylation | HLIEHRRTHTGEKPY HHHHCCCCCCCCCCE | 24.60 | - | |
| 640 | Phosphorylation | IEHRRTHTGEKPYIC HHCCCCCCCCCCEEE | 46.56 | - | |
| 727 | Sumoylation | TQIHTDEKPF----- CEECCCCCCC----- | 55.31 | - | |
| 727 | Sumoylation | TQIHTDEKPF----- CEECCCCCCC----- | 55.31 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN778_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN778_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN778_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
