UniProt ID | ZN75A_HUMAN | |
---|---|---|
UniProt AC | Q96N20 | |
Protein Name | Zinc finger protein 75A | |
Gene Name | ZNF75A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 296 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQRIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MYFSQEEWE ------CCCCHHHHH | 16.37 | 24043423 | |
4 | Phosphorylation | ----MYFSQEEWELL ----CCCCHHHHHHC | 21.13 | 24043423 | |
14 | Phosphorylation | EWELLDPTQKALYND HHHHCCHHHHHHHHH | 42.22 | 24043423 | |
68 | Phosphorylation | FKDSAGKSPTGLKLK HHCCCCCCCCCCCCC | 27.12 | 25849741 | |
138 | Phosphorylation | VKKRKKLSTWKQELL HHHHHCHHHHHHHHH | 40.89 | 29449344 | |
139 | Phosphorylation | KKRKKLSTWKQELLK HHHHCHHHHHHHHHH | 47.30 | 29449344 | |
209 | Phosphorylation | SDLNKHLTTHQGIKP HHHHHHHCCCCCCCC | 23.19 | 22210691 | |
210 | Phosphorylation | DLNKHLTTHQGIKPY HHHHHHCCCCCCCCE | 20.68 | 22210691 | |
238 | Phosphorylation | NLHTHQRTHTGEKPF CCCCCCCCCCCCCCE | 19.74 | - | |
240 | Phosphorylation | HTHQRTHTGEKPFTC CCCCCCCCCCCCEEH | 46.56 | - | |
286 | Phosphorylation | RRNFSRRSSLLRHQK CCCCCCCHHHHHHHC | 24.99 | 23927012 | |
287 | Phosphorylation | RNFSRRSSLLRHQKL CCCCCCHHHHHHHCC | 29.61 | 23927012 | |
309 | Phosphorylation | -------------------- -------------------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN75A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN75A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN75A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...