ZN720_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZN720_HUMAN
• UniProt AC: Q7Z2F6
• Protein Name: Putative protein ZNF720
• Gene Name: ZNF720
• Organism: Homo sapiens (Human).
• Sequence Length: 126
• Protein Sequence: MGLLTFRDVAIEFSREEWEHLDSDQKLLYGDVMLENYGNLVSLGLAVSKPDLITFLEQRKEPWNVKSAETVAIQPDIFSHDTQGLLRKKLIEASFQKVILDGYGSCGPQNLNLRKEWESEGKIILW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
54	Phosphorylation	VSKPDLITFLEQRKE CCCHHHHHHHHHCCC	29.48	21406692
60	Ubiquitination	ITFLEQRKEPWNVKS HHHHHHCCCCCCCCC	68.75	-
86 (in isoform 2)	Phosphorylation	-	10.90	24076635
94 (in isoform 2)	Phosphorylation	-	18.54	24076635
99 (in isoform 2)	Phosphorylation	-	3.60	24076635
101 (in isoform 2)	Phosphorylation	-	36.82	24247654
111 (in isoform 2)	Phosphorylation	-	5.56	24247654

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZN720_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZN720_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZN720_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.