| UniProt ID | ZN706_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5V0 | |
| Protein Name | Zinc finger protein 706 {ECO:0000305} | |
| Gene Name | ZNF706 {ECO:0000312|HGNC:HGNC:24992} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 76 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.. | |
| Protein Sequence | MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Ubiquitination | KKQGHDQKAAAKAAL HHCCCHHHHHHHHHH | 46.15 | 29967540 | |
| 30 | Acetylation | KKQGHDQKAAAKAAL HHCCCHHHHHHHHHH | 46.15 | 26051181 | |
| 34 | Acetylation | HDQKAAAKAALIYTC CHHHHHHHHHHHHHH | 29.48 | 25953088 | |
| 39 | Phosphorylation | AAKAALIYTCTVCRT HHHHHHHHHHHHHHC | 9.16 | 25159151 | |
| 40 | Phosphorylation | AKAALIYTCTVCRTQ HHHHHHHHHHHHHCC | 8.49 | - | |
| 52 | Ubiquitination | RTQMPDPKTFKQHFE HCCCCCHHHHHHHHH | 74.17 | 23000965 | |
| 52 | Acetylation | RTQMPDPKTFKQHFE HCCCCCHHHHHHHHH | 74.17 | 26051181 | |
| 55 | Ubiquitination | MPDPKTFKQHFESKH CCCHHHHHHHHHCCC | 48.36 | 23000965 | |
| 61 | Ubiquitination | FKQHFESKHPKTPLP HHHHHHCCCCCCCCC | 57.64 | 23000965 | |
| 64 | Ubiquitination | HFESKHPKTPLPPEL HHHCCCCCCCCCHHH | 63.59 | 23000965 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN706_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN706_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN706_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| SP100_HUMAN | SP100 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
