UniProt ID | ZN365_HUMAN | |
---|---|---|
UniProt AC | Q70YC5 | |
Protein Name | Protein ZNF365 | |
Gene Name | ZNF365 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 407 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . localizes to the centrosome at all stages of the cell cycle. | |
Protein Description | Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth. [PubMed: 17389905 Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (By similarity Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery] | |
Protein Sequence | MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Ubiquitination | ----MQQKAFEESRY ----CCCHHHHHHCC | 37.84 | 30230243 | |
9 | Phosphorylation | QQKAFEESRYPWQES CCHHHHHHCCCCHHH | 29.89 | 24719451 | |
16 | Phosphorylation | SRYPWQESFENVAVC HCCCCHHHHCCEEEE | 23.82 | 24719451 | |
39 | Phosphorylation | GDHTRFRSLSSLRAH CCCHHCCCHHHHHHH | 29.86 | 22167270 | |
41 | Phosphorylation | HTRFRSLSSLRAHLE CHHCCCHHHHHHHHH | 28.68 | 22167270 | |
42 | Phosphorylation | TRFRSLSSLRAHLEF HHCCCHHHHHHHHHH | 27.45 | 22167270 | |
61 | Ubiquitination | EERTLLTKCSLFPSL HHHHHHHHHCCCCCC | 23.07 | 30230243 | |
69 | Ubiquitination | CSLFPSLKDTDLVTS HCCCCCCCCCCCCCH | 64.02 | 30230243 | |
81 | Acetylation | VTSSELLKPGKLQSS CCHHHHCCCCCCCCC | 65.43 | 11688369 | |
84 | Ubiquitination | SELLKPGKLQSSGNV HHHCCCCCCCCCCCE | 52.45 | 30230243 | |
97 | Phosphorylation | NVVKQKPSYVNLYSI CEEECCCCEEEEEEC | 49.07 | 24850871 | |
138 | Phosphorylation | AMDLHADSLDGTRSG EEECCCCCCCCCCCC | 29.19 | - | |
154 | Ubiquitination | GLPTSDTKASFEAHV CCCCCCCHHHHHHHH | 47.20 | 30230243 | |
175 | Phosphorylation | MVEAVDRTIEKRIDK HHHHHHHHHHHHHHH | 29.08 | - | |
239 | Phosphorylation | LRQRLTESEEELLRK HHHHCCCCHHHHHHH | 45.10 | 22210691 | |
287 | Ubiquitination | QRVELAEKQLEYYQS HHHHHHHHHHHHHHH | 55.35 | 30230243 | |
291 | Phosphorylation | LAEKQLEYYQSQQAS HHHHHHHHHHHHHHH | 18.52 | - | |
305 | Phosphorylation | SGFVRDLSGHVLTDI HCCCCCCCCCCEEEC | 31.01 | 24076635 | |
310 | Phosphorylation | DLSGHVLTDISSNRK CCCCCCEEECCCCCC | 30.14 | 24719451 | |
369 | Phosphorylation | AIHEQAESSRDLCRP HHHHHHHHCCHHCCC | 33.42 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN365_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN365_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN365_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...