ZEN1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZEN1_DROME
• UniProt AC: P09089
• Protein Name: Protein zerknuellt 1
• Gene Name: zen
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 353
• Subcellular Localization: Nucleus .
• Protein Description: Required for the differentiation of the dorsal-ventral pattern, and does not appear to be involved in the process of segmentation..
• Protein Sequence: MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTSYNYPN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
169	Phosphorylation	AQPQAEQSAHRGIVK CCHHHHHHHHHHHHH	19.97	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZEN1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZEN1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZEN1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MAD_DROME	Mad	physical	14605208
MED4_DROME	MED4	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.