dbPTM

YPT3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YPT3_SCHPO
UniProt AC	P17610
Protein Name	GTP-binding protein ypt3
Gene Name	ypt3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	214
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side . Endosome membrane Lipid-anchor . Golgi apparatus membrane Lipid-anchor . Cytoplasm . Nucleus .
Protein Description	Has a role in retrograde traffricking of proteins from the endosome to the Golgi. Involved in the secretory pathway where it has a role in acid phosphatase secretion..
Protein Sequence	MCQEDEYDYLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLLHLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDDGVHPTAGQTLNIAPTMNDLNKKKSSSQCC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	EFNIESKSTIGVEFA CCCCCCCCEEEEEEE	34.24	25720772
42	Phosphorylation	FNIESKSTIGVEFAT CCCCCCCEEEEEEEE	26.03	28889911
179	Phosphorylation	FRIVSNRSLEAGDDG HHHHHCCCCCCCCCC	34.51	29996109
213	Geranylgeranylation	KKKSSSQCC------ CCCCCCCCC------	3.00	1597466
213	Geranylgeranylation	KKKSSSQCC------ CCCCCCCCC------	3.00	1597466
214	Geranylgeranylation	KKSSSQCC------- CCCCCCCC-------	4.91	1597466
214	Geranylgeranylation	KKSSSQCC------- CCCCCCCC-------	4.91	1597466

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YPT3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YPT3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YPT3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RYH1_SCHPO	ryh1	genetic	16483310
PP2B_SCHPO	ppb1	genetic	12181359
CIS4_SCHPO	cis4	genetic	18199682
RYH1_SCHPO	ryh1	genetic	21035342
GYP10_SCHPO	gyp10	genetic	24350606

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YPT3_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-42, AND MASSSPECTROMETRY.	18257517 [Abstract]
Prenylation
Reference	PubMed
"Post-translational processing of Schizosaccharomyces pombe YPTproteins."; Newman C.M., Giannakouros T., Hancock J.F., Fawell E.H., Armstrong J.,Magee A.I.; J. Biol. Chem. 267:11329-11336(1992). Cited for: ISOPRENYLATION AT CYS-213 AND CYS-214.	1597466 [Abstract]