YLV1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YLV1_SCHPO
• UniProt AC: O94392
• Protein Name: Uncharacterized transcriptional regulatory protein C2H10.01
• Gene Name: SPAC2H10.01
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 480
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MTQKNTGPRRRTAVACDRCRRRKIRCTGSDIPGQPCLACQKAHADCHFSTTSWRACRKKSAPLHCPSTNGKTNVLPSYASTPSLSPMTSSHFPYASDGTLISATNHCDDCSYNPHYLPVNSNGSSPSHTSSLDSIPGYASGSGPFKTPYRPVAVSESSSRSSFSMGSSEFASSTWSQSPMQSSLYVSPSSQPLDRFSPASFPSKETLTSSSLSSSVPRSVSLSNFADSNTSNYPESSLLPAAKVGNNGFVGSNVLGSMSYSNVEDSVRFQTDSVSQMSSKSLEHLPMLSEMTLSSSASFGASVSPKSTPGSNSTGAAVDTNSVHSNGGSDLDYSSYLTDSSAVDSPSLDADEVLRSFNLANDPIGAVDPLTLEIDQGSGSQLLGQQSFANDSLNAKQSSGKLGPLPPQSFNSSDYISFDEPSRYLSDDASLWPDQYVDKVQPLATMKTCNPAVFSSNTSLDDMFFFIRDFDEDHPIQTAY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
208	Phosphorylation	FPSKETLTSSSLSSS CCCCHHCCCCCCCCC	33.70	27738172
221	Phosphorylation	SSVPRSVSLSNFADS CCCCCEEEHHHCCCC	27.59	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YLV1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YLV1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YLV1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AP1M1_SCHPO	apm1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.