dbPTM

YL89_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YL89_SCHPO
UniProt AC	Q9UTA9
Protein Name	Uncharacterized methyltransferase C25B8.09
Gene Name	SPAC25B8.09
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	251
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Probable methyltransferase..
Protein Sequence	MIGRTFKTDIADYETARPDYPPQITEWLNDEFSVNETSTILELGAGSGKLTPRIIASQPKEIIAVDTYVEMLDVLKKKFPNVDCRVGSAMAIPLEDESVDLVACGQCFHWFANEEALKEIYRVLKPNGKLALIWNIRDNSVPWVEKCSQLLEKCRGGPLNMFEKAAELFPGYGFTELKQSLFTSAKKYSIEDLHRLMNSFSSINRLPVEEKEKMHAELDEIIKTIPRAQNTDQVDFNILTVAYSSEKVPIN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YL89_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YL89_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YL89_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YL89_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YL89_SCHPO	SPAC25B8.09	physical	26771498
MOC3_SCHPO	moc3	physical	26771498
GLRX3_SCHPO	grx3	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YL89_SCHPO

Related Literatures of Post-Translational Modification