| UniProt ID | YL87_SCHPO | |
|---|---|---|
| UniProt AC | Q9UTB1 | |
| Protein Name | HIG1 domain-containing protein C25B8.07c, mitochondrial | |
| Gene Name | SPAC25B8.07c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 113 | |
| Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MSSKLPKKSEENLELPTFPASEESLSRSEKLKYVFVRNPFIPLGCLMTVGTFLASGYYIRRENHLMANKFMRYRVMSQGFTLAALAFSVLFIGPPRREAPSNSSGSINSEIKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YL87_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL87_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL87_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL87_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HSV2_SCHPO | atg1803 | genetic | 18818364 | |
| YBPD_SCHPO | SPBC16H5.13 | genetic | 18818364 | |
| HIR1_SCHPO | hip1 | genetic | 18818364 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...