HSV2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HSV2_SCHPO
• UniProt AC: Q9P3W2
• Protein Name: SVP1-like protein 2
• Gene Name: hsv2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 364
• Subcellular Localization: Vacuole membrane; Peripheral membrane protein. Cytoplasmic vesicle membrane; Peripheral membrane protein. Preautophagosomal structure membrane ; Peripheral membrane protein .
• Protein Description: Involved in mitochondrial or peroxisomal functions and amino acid signaling pathways..
• Protein Sequence: MSTINTVSLNQDASCMSVALDTGYKIFQINPLKLRAQRQFNDGGLSIVKMLFRSNVLLLVGGGGNPKYAPNKLIVWDDVKERPVKELELNFEIKGICFDGKLLAIATASKLFLYQFGNNLKLQRCLDTQNPKGLCAMVTTVEKTAIVFPSRKVGQLQILFLFKDHMNTSIVPAHDSEISCLGISKTGSKIASSSTNGTLIRIWNSETGEKICEFRRGYQHTAVCQLAFSPDELLLACASKKETLHIFSLHGSPNTIRQLTSEEPYEEASEFKSSTTEPRQTHWKRKLLKLIDSGKRAHWRIQLYQSNPVLLHWLDEMTILICYKDAAYQKLKLTIEESSKSVEHANQHVCFHYDYTLEADGSLC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of HSV2_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HSV2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HSV2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HSV2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ASH2_SCHPO	ash2	genetic	18818364
YIT2_SCHPO	SPAC105.02c	genetic	22681890
PFL9_SCHPO	pfl9	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.