YK12_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YK12_SCHPO
• UniProt AC: Q9HDY7
• Protein Name: Uncharacterized protein PB1A10.02
• Gene Name: SPAPB1A10.02
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 336
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MCNRQPKAVDLPPNYSCPHLLSFQSVEFNTNPTACDDVFCKRIESEKKYNDFLESLFKKYGRDTSDIADEVDLATGEIIVNNGHLEALKTKDDIWDPTFNNLEISASNGYEKKLDSSIGNPGEKAVSPVHIEDFQSPQIYKFKNLSLRDEMVSDCVFADEVPLASLFVENVCNETIPSQSCVRLKINDKTRKVDASALEKKSCLLPNSSGTLTDQRGLDTIKHKSIEQNEILHVISDTLSSPRRRNPLLSSPKTPLRRSFSKSKVRNSNSTKRRNFISLISMISPRPNLSTHHFNLGFQPLSQQTSFSGSSTQNPHSSSTCKKAFCFQCISESKKC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
127	Phosphorylation	NPGEKAVSPVHIEDF CCCCCCCCCCCHHHC	26.51	25720772
136	Phosphorylation	VHIEDFQSPQIYKFK CCHHHCCCCCEEEEC	20.83	24763107
241	Phosphorylation	VISDTLSSPRRRNPL HHHHCCCCCCCCCCC	26.07	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YK12_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YK12_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YK12_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIM3_SCHPO	sim3	genetic	12719471
SIM4_SCHPO	sim4	genetic	12719471
MIS6_SCHPO	mis6	genetic	12719471
CENPA_SCHPO	cnp1	genetic	12719471
CENPA_SCHPO	cnp1	physical	24186062
YG7G_SCHPO	mis20	genetic	24789708

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.