UniProt ID | YK12_SCHPO | |
---|---|---|
UniProt AC | Q9HDY7 | |
Protein Name | Uncharacterized protein PB1A10.02 | |
Gene Name | SPAPB1A10.02 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 336 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MCNRQPKAVDLPPNYSCPHLLSFQSVEFNTNPTACDDVFCKRIESEKKYNDFLESLFKKYGRDTSDIADEVDLATGEIIVNNGHLEALKTKDDIWDPTFNNLEISASNGYEKKLDSSIGNPGEKAVSPVHIEDFQSPQIYKFKNLSLRDEMVSDCVFADEVPLASLFVENVCNETIPSQSCVRLKINDKTRKVDASALEKKSCLLPNSSGTLTDQRGLDTIKHKSIEQNEILHVISDTLSSPRRRNPLLSSPKTPLRRSFSKSKVRNSNSTKRRNFISLISMISPRPNLSTHHFNLGFQPLSQQTSFSGSSTQNPHSSSTCKKAFCFQCISESKKC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
127 | Phosphorylation | NPGEKAVSPVHIEDF CCCCCCCCCCCHHHC | 26.51 | 25720772 | |
136 | Phosphorylation | VHIEDFQSPQIYKFK CCHHHCCCCCEEEEC | 20.83 | 24763107 | |
241 | Phosphorylation | VISDTLSSPRRRNPL HHHHCCCCCCCCCCC | 26.07 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YK12_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YK12_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YK12_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SIM3_SCHPO | sim3 | genetic | 12719471 | |
SIM4_SCHPO | sim4 | genetic | 12719471 | |
MIS6_SCHPO | mis6 | genetic | 12719471 | |
CENPA_SCHPO | cnp1 | genetic | 12719471 | |
CENPA_SCHPO | cnp1 | physical | 24186062 | |
YG7G_SCHPO | mis20 | genetic | 24789708 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...