dbPTM

YJKA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YJKA_SCHPO
UniProt AC	Q9USL1
Protein Name	Uncharacterized WD repeat-containing protein C18B5.10c
Gene Name	SPCC18B5.10c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	309
Subcellular Localization
Protein Description
Protein Sequence	MCASVTESLPKFPELKTRDLQGQQGPIRSLGWNLSGSRLASSSSSGSVLVWNSDRLDFKFTTELGNRGYGLVEQLVWDPTHSDRLMAVYAGKMIRFWDFRSAKPIAEIESNYENIYATWSPSGNYCCASSRDDMLSFIDARERRIMETFQQPCETNECCWSFSEDLFFMTTGLGTVQIMEWPSLKRVYDIKAHNSNCFCIEFSPDNRHLAIGGADAITSLWDPQELICERSITRMDYPIRTLSFSYDSRYLASGSEDRYVDIADTKTGDQIWKIPTNGPLNKVAWHPTKHILAYAVSEPNSSGLKIFGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YJKA_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YJKA_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YJKA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YJKA_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LUB1_SCHPO	lub1	genetic	22681890
CTBL1_SCHPO	SPAC1952.06c	genetic	22681890
RAD17_SCHPO	rad17	genetic	22681890
GET1_SCHPO	get1	genetic	22681890
DAD1_SCHPO	dad1	genetic	22681890
PAB2_SCHPO	pab2	genetic	22681890
PTPA1_SCHPO	ypa1	genetic	22681890
CAND1_SCHPO	knd1	genetic	22681890
ALM1_SCHPO	alm1	genetic	22681890
IWR1_SCHPO	iwr1	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YJKA_SCHPO

Related Literatures of Post-Translational Modification