YEMB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YEMB_SCHPO
• UniProt AC: O14032
• Protein Name: UPF0664 stress-induced protein C29B12.11c
• Gene Name: SPAC29B12.11c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 174
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MSINWVTYKEGSESDILLLENECMFDCFDGVAISILCKPPSLKSWTCTKGLLCLTNQRLVYIAKDTDCDFKDFQSPVANLKDTKLNQPFFGANYYSGTVMPVPNGGIPCEAEVKLQFNEGGIFNFVEAWNRLIQRFQEVDSVSRVQHLDPLPPYHRPSSSQDQPPHYEEAVNKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
154	Phosphorylation	HLDPLPPYHRPSSSQ ECCCCCCCCCCCCCC	14.44	29996109
158	Phosphorylation	LPPYHRPSSSQDQPP CCCCCCCCCCCCCCC	42.45	29996109
159	Phosphorylation	PPYHRPSSSQDQPPH CCCCCCCCCCCCCCC	34.40	29996109
160	Phosphorylation	PYHRPSSSQDQPPHY CCCCCCCCCCCCCCH	41.96	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YEMB_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YEMB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YEMB_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VPS17_SCHPO	vps17	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.