UniProt ID | YEM4_YEAST | |
---|---|---|
UniProt AC | P40022 | |
Protein Name | Uncharacterized protein YER034W | |
Gene Name | YER034W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 185 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDAFSLKKDNRKKFQDKQKLKRKHATPSDRKYRLLNRQKEEKATTEEKDQDQEQPALKSNEDRYYEDPVLEDPHSAVANAELNKVLKDVLKNRLQQNDDATAVNNVANKDTLKIKDLKQMNTDELNRWLGRQNTTSAITAAEPESLVVPIHVQGDHDRAGKKISAPSTDLPEELETDQDFLDGLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDAFSLKK -------CCCCCCCC | 8.28 | 22814378 | |
48 | Ubiquitination | EKATTEEKDQDQEQP HHCCCHHCCCHHHCC | 55.23 | 23749301 | |
58 | Acetylation | DQEQPALKSNEDRYY HHHCCCHHCCCCHHC | 54.03 | 25381059 | |
87 | Acetylation | AELNKVLKDVLKNRL HHHHHHHHHHHHHHH | 49.10 | 25381059 | |
109 | Acetylation | AVNNVANKDTLKIKD HHHHHCCCCCCCHHH | 42.21 | 24489116 | |
115 | Acetylation | NKDTLKIKDLKQMNT CCCCCCHHHHHHCCH | 56.26 | 24489116 | |
122 | Phosphorylation | KDLKQMNTDELNRWL HHHHHCCHHHHHHHH | 26.05 | 28889911 | |
167 | Phosphorylation | GKKISAPSTDLPEEL CCCCCCCCCCCCHHH | 33.98 | 21440633 | |
176 | Phosphorylation | DLPEELETDQDFLDG CCCHHHCCCHHHHHH | 52.14 | 21440633 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YEM4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YEM4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YEM4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC3_YEAST | CDC34 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...