dbPTM

Y3126_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y3126_ARATH
UniProt AC	Q9M2D8
Protein Name	Uncharacterized protein At3g61260
Gene Name	At3g61260
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	212
Subcellular Localization	Cell membrane .
Protein Description
Protein Sequence	MAEEQKIALESESPAKVTTPAPADTPAPAPAEIPAPAPAPTPADVTKDVAEEKIQNPPPEQIFDDSKALTVVEKPVEEPAPAKPASASLDRDVKLADLSKEKRLSFVRAWEESEKSKAENKAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEETAAKYRATGIVPKATCGCF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	EQKIALESESPAKVT HHHHHHHCCCCCCCC	44.20	19880383
13	Phosphorylation	KIALESESPAKVTTP HHHHHCCCCCCCCCC	39.16	30291188
18	Phosphorylation	SESPAKVTTPAPADT CCCCCCCCCCCCCCC	26.76	19376835
19	Phosphorylation	ESPAKVTTPAPADTP CCCCCCCCCCCCCCC	22.05	19376835
25	Phosphorylation	TTPAPADTPAPAPAE CCCCCCCCCCCCCCC	24.37	19376835
41	Phosphorylation	PAPAPAPTPADVTKD CCCCCCCCCCCCCHH	32.96	19376835
46	Phosphorylation	APTPADVTKDVAEEK CCCCCCCCHHHHHHH	23.29	19376835
70	Phosphorylation	FDDSKALTVVEKPVE CCCCCCEEEEECCCC	27.62	19376835
86	Phosphorylation	PAPAKPASASLDRDV CCCCCCCCCCCCCCC	27.24	17317660
88	Phosphorylation	PAKPASASLDRDVKL CCCCCCCCCCCCCCH	28.45	23111157
99	Phosphorylation	DVKLADLSKEKRLSF CCCHHHCCHHHHHHH	39.04	25561503
105	Phosphorylation	LSKEKRLSFVRAWEE CCHHHHHHHHHHHHH	26.23	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y3126_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y3126_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y3126_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
POP3_ARATH	HS1	physical	24833385
TPIS_ARATH	TPI	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
RAC8_ARATH	ROP10	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y3126_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-13 AND SER-105, AND MASSSPECTROMETRY.	19376835 [Abstract]
"Temporal analysis of sucrose-induced phosphorylation changes inplasma membrane proteins of Arabidopsis."; Niittylae T., Fuglsang A.T., Palmgren M.G., Frommer W.B.,Schulze W.X.; Mol. Cell. Proteomics 6:1711-1726(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11 AND SER-105, AND MASSSPECTROMETRY.	17586839 [Abstract]
"Phosphoproteomics of the Arabidopsis plasma membrane and a newphosphorylation site database."; Nuehse T.S., Stensballe A., Jensen O.N., Peck S.C.; Plant Cell 16:2394-2405(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-13, AND MASSSPECTROMETRY.	15308754 [Abstract]