dbPTM

Y1106_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y1106_ARATH
UniProt AC	Q6NLU6
Protein Name	Uncharacterized protein At1g31060
Gene Name	At1g31060
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	106
Subcellular Localization
Protein Description
Protein Sequence	MLREECTPSSSWWEDVQHHHNDHANSISSTSFYHKSSNNNSHANASCEEDNLSVSTVRASNRLDLTAESSNHHSLSASNQPASSSDELLRDHVVSSHNHLWSLAFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
46	Phosphorylation	NNSHANASCEEDNLS CCCCCCCCCCCCCCE	23.13	30407730
53	Phosphorylation	SCEEDNLSVSTVRAS CCCCCCCEEEEEEEC	21.92	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y1106_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y1106_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y1106_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UNE12_ARATH	UNE12	physical	21798944
CDC23_ARATH	APC8	physical	21798944
ASIL1_ARATH	ASIL1	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y1106_ARATH

Related Literatures of Post-Translational Modification