dbPTM

XDH_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	XDH_SCHPO
UniProt AC	Q9UT60
Protein Name	Probable D-xylose 1-dehydrogenase (NADP(+)) {ECO:0000305}
Gene Name	dhd1 {ECO:0000312\|PomBase:SPAC513.06c}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	368
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	NADP-dependent D-xylose dehydrogenase catalyzing the oxydation of D-xylose into D-xylonolactone (By similarity). May also display activity with other sugars. May play a role in the regeneration of NADP(+) in the presence of these sugars (Probable)..
Protein Sequence	MTSMSGASPVIHWGFLGAGSIAAVFAKDLVGVPERHKVQHEIVAVATRDSEHRASSFAKNHCAPCKPKAYGSYEELVKDDKVDIVYISSTHPQHYEVVKLALLNDKAVLCEKPLTINYPEALELVELARARNLFFAEGFWIRFYPIVKAAKTLLHEDRVCGDHFRLFVDFSQDFRFRELPSESRLRTVSLGAGVLLDMGVYPLTWSRLLLYDDPKNEKQEPTVSSNALTFEDHNGDIGDYTTAVTLVFPKTESIAMLCTSMDRGKMSDDFLKLDGENGNQLFISGDCYRPQSIKLIRASGETEVFDFSFDDATGFFYEQDAVAECLLKNMKEAPEIPHEETLKMMQLTDQIRRQINVTYPADLRYTTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of XDH_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of XDH_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of XDH_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of XDH_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
XDH_SCHPO	SPAC513.06c	physical	26771498
CBH1_SCHPO	cbh1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of XDH_SCHPO

Related Literatures of Post-Translational Modification