UniProt ID | XDH_SCHPO | |
---|---|---|
UniProt AC | Q9UT60 | |
Protein Name | Probable D-xylose 1-dehydrogenase (NADP(+)) {ECO:0000305} | |
Gene Name | dhd1 {ECO:0000312|PomBase:SPAC513.06c} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 368 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | NADP-dependent D-xylose dehydrogenase catalyzing the oxydation of D-xylose into D-xylonolactone (By similarity). May also display activity with other sugars. May play a role in the regeneration of NADP(+) in the presence of these sugars (Probable).. | |
Protein Sequence | MTSMSGASPVIHWGFLGAGSIAAVFAKDLVGVPERHKVQHEIVAVATRDSEHRASSFAKNHCAPCKPKAYGSYEELVKDDKVDIVYISSTHPQHYEVVKLALLNDKAVLCEKPLTINYPEALELVELARARNLFFAEGFWIRFYPIVKAAKTLLHEDRVCGDHFRLFVDFSQDFRFRELPSESRLRTVSLGAGVLLDMGVYPLTWSRLLLYDDPKNEKQEPTVSSNALTFEDHNGDIGDYTTAVTLVFPKTESIAMLCTSMDRGKMSDDFLKLDGENGNQLFISGDCYRPQSIKLIRASGETEVFDFSFDDATGFFYEQDAVAECLLKNMKEAPEIPHEETLKMMQLTDQIRRQINVTYPADLRYTTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of XDH_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XDH_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XDH_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XDH_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XDH_SCHPO | SPAC513.06c | physical | 26771498 | |
CBH1_SCHPO | cbh1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...