WRK17_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WRK17_ARATH
• UniProt AC: Q9SJA8
• Protein Name: Probable WRKY transcription factor 17
• Gene Name: WRKY17
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 321
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity)..
• Protein Sequence: MTVDIMRLPKMEDQTAIQEAASQGLKSMEHLIRVLSNRPEERNVDCSEITDFTVSKFKKVISLLNRSGHARFRRGPVHSPPSSSVPPPVKVTTPAPTQISAPAPVSFVQANQQSVTLDFTRPSVFGAKTKSSEVVEFAKESFSVSSNSSFMSSAITGDGSVSKGSSIFLAPAPAVPVTSSGKPPLSGLPYRKRCFEHDHSEGFSGKISGSGNGKCHCKKSRKNRMKRTVRVPAVSAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRHHQSTMQEHVTPSVSGLVFGSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of WRK17_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WRK17_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WRK17_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WRK17_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BOI_ARATH	RING	physical	21798944
PAP1_ARATH	FIB	physical	21798944
2AB2C_ARATH	AT5G28900	physical	21798944
OBE1_ARATH	OBE1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.