UniProt ID | WNK4_ARATH | |
---|---|---|
UniProt AC | Q9LVL5 | |
Protein Name | Probable serine/threonine-protein kinase WNK4 | |
Gene Name | WNK4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 571 | |
Subcellular Localization | ||
Protein Description | May regulate flowering time by modulating the photoperiod pathway.. | |
Protein Sequence | MNMNQVAEYVETDPTGRYGRFAEILGRGAMKTVYKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVHNHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLARMLRDCHSAHSIIGTPEFMAPELYEENYNELIDVYSFGMCFLEMITSEFPYSECNHPAQIYKKVVGGKLPGAFYRVGDIEAQRFIGKCLVSASKRVSAKELLQDPFLASDESWMVYTSGAGNPKPFLNENEMDTLKLEDDELRTEMSIAGKLGAEDNKIDLEVQIAYDNGLANNVFFPFDIMNDTSIDVAKEMVKELEIIDWEPVEIAKMIDGAISSLVSDWKYEEDDETPHDHHRHRTDSFHSSSSHASSSQASLSNYMARGLQDWVQDDLHDETYSQSSSHSGSYSNLNYIAVDEYSSQSPVMSRTHNMTRFCPEESSHLQSGQANAYAASSSTNRSLASDNRTLTRNRSLVDVQRQLLHRSPGEEARKRRLFKTVGDVETVGFQSPYAVSRKPPSSRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
522 | Phosphorylation | RTLTRNRSLVDVQRQ CCCCCCHHHHHHHHH | 35.97 | 19880383 | |
547 | Phosphorylation | RKRRLFKTVGDVETV HHHHHHCCCCCCEEC | 23.53 | 30589143 | |
558 | Phosphorylation | VETVGFQSPYAVSRK CEECCCCCCCHHCCC | 20.02 | 30589143 | |
563 | Phosphorylation | FQSPYAVSRKPPSSR CCCCCHHCCCCCCCC | 26.81 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNK4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNK4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNK4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WNK4_ARATH | WNK4 | physical | 25969537 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-522, AND MASSSPECTROMETRY. | |
"Phosphoproteomic analysis of nuclei-enriched fractions fromArabidopsis thaliana."; Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A.,Andreasson E., Rathjen J.P., Peck S.C.; J. Proteomics 72:439-451(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-522, AND MASSSPECTROMETRY. |