VRK1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VRK1_MOUSE
• UniProt AC: Q80X41
• Protein Name: Serine/threonine-protein kinase VRK1
• Gene Name: Vrk1
• Organism: Mus musculus (Mouse).
• Sequence Length: 440
• Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle. Dispersed throughout the cell but not located on mitotic spindle or chromatids during mitosis.
• Protein Description: Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity (By similarity)..
• Protein Sequence: MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Phosphorylation	FAAGEVLTDMSRKEW HHHCCHHHHCCHHHH	34.53	25619855
33	Phosphorylation	GEVLTDMSRKEWKLG CCHHHHCCHHHHHCC	42.90	25619855
158	Phosphorylation	RKTVLQLSLRILDIL HHHHHHHHHHHHHHH	11.57	22942356
186	Phosphorylation	KASNLLLSHKNPDQV CHHHHHHCCCCCCCE	32.17	30635358
194	Phosphorylation	HKNPDQVYLVDYGLA CCCCCCEEEEECCEE	8.72	-
314	Acetylation	KLLEYTEKPLYQNLR HHHHCCCCHHHHCHH	32.30	23806337
342	Phosphorylation	DDGKLDFSAVENGSV CCCCCCCEEEECCCC	30.95	-
348	Phosphorylation	FSAVENGSVKTRPAS CEEEECCCCCCCCCC	31.83	29176673
355	Phosphorylation	SVKTRPASKKRKKEA CCCCCCCCHHHHHHH	41.20	21346188
365	Phosphorylation	RKKEAEESAVCAVED HHHHHHHHCEEEEEC	19.94	25777480
376	Phosphorylation	AVEDMECSDTQVQEA EEECCCCCHHHHHHH	30.32	27087446
378	Phosphorylation	EDMECSDTQVQEAAQ ECCCCCHHHHHHHHH	17.85	25159016
388	Phosphorylation	QEAAQTRSVESQGAI HHHHHHCCHHHHCCC	33.36	28973931
407	Phosphorylation	SQPAAGCSSSDSSRR CCCCCCCCCCCHHHH	31.77	26239621
408	Phosphorylation	QPAAGCSSSDSSRRQ CCCCCCCCCCHHHHH	42.09	26239621
409	Phosphorylation	PAAGCSSSDSSRRQQ CCCCCCCCCHHHHHH	25.81	26239621
411	Phosphorylation	AGCSSSDSSRRQQHL CCCCCCCHHHHHHHH	27.91	26643407
412	Phosphorylation	GCSSSDSSRRQQHLG CCCCCCHHHHHHHHC	36.15	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
342	S	Phosphorylation	Kinase	PLK3	Q60806	Uniprot
355	S	Phosphorylation	Kinase	PRKCD	Q05655	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VRK1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VRK1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZZEF1_HUMAN	ZZEF1	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.