UniProt ID | VPX_HV2BE | |
---|---|---|
UniProt AC | P18099 | |
Protein Name | Protein Vpx | |
Gene Name | vpx | |
Organism | Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2). | |
Sequence Length | 113 | |
Subcellular Localization | Virion. Host nucleus. Nuclear just after virion uncoating, or if expressed in the absence of unprocessed GAG.. | |
Protein Description | Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.. | |
Protein Sequence | MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VPX_HV2BE !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPX_HV2BE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPX_HV2BE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPX_HV2BE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DCAF1_HUMAN | VPRBP | physical | 22386056 | |
DCAF1_HUMAN | VPRBP | physical | 18829761 | |
DCAF1_HUMAN | VPRBP | physical | 22776683 | |
SAMH1_HUMAN | SAMHD1 | physical | 22776683 | |
SAMH1_HUMAN | SAMHD1 | physical | 22973040 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...