VPS45_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VPS45_ARATH
• UniProt AC: O49048
• Protein Name: Vacuolar protein sorting-associated protein 45 homolog
• Gene Name: VPS45
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 569
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein. Binds to trans-Golgi network membranes through interaction with other proteins.
• Protein Description: Involved in the protein transport to the vacuole, probably at the level of vesicle fusion at the trans-Golgi network (TGN) and not in transport from the TGN to the prevacuolar compartment. Binds syntaxins..
• Protein Sequence: MVLVTSVRDYINRMLQDISGMKVLILDSETVSNVSIVYSQSELLQKEVFLVEMIDSISVSKESMSHLKAVYFIRPTSDNIQKLRYQLANPRFGEYHLFFSNLLKDTQIHILADSDEQEVVQQVQEYYADFVSGDPYHFTLNMASNHLYMIPAVVDPSGLQRFSDRVVDGIAAVFLALKRRPVIRYQRTSDTAKRIAHETAKLMYQHESALFDFRRTESSPLLLVIDRRDDPVTPLLNQWTYQAMVHELIGLQDNKVDLKSIGSLPKDQQVEVVLSSEQDAFFKSNMYENFGDIGMNIKRMVDDFQQVAKSNQNIQTVEDMARFVDNYPEYKKMQGNVSKHVTLVTEMSKLVEARKLMTVSQTEQDLACNGGQGAAYEAVTDLLNNESVSDIDRLRLVMLYALRYEKENPVQLMQLFNKLASRSPKYKPGLVQFLLKQAGVEKRTGDLFGNRDLLNIARNMARGLKGVENVYTQHQPLLFQTMESITRGRLRDVDYPFVGDHFQQGRPQEVVIFMVGGTTYEESRSVALQNATNSGVRFILGGTAVLNSKRFLKDLEEAQRISRSGSHMV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Phosphorylation	MSHLKAVYFIRPTSD HHCCEEEEEECCCCH	9.73	19880383
338	Phosphorylation	KKMQGNVSKHVTLVT HHCCCCHHHHHHHHH	22.50	19880383
342	Phosphorylation	GNVSKHVTLVTEMSK CCHHHHHHHHHHHHH	18.41	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VPS45_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VPS45_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VPS45_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VTI12_ARATH	VTI1B	physical	10888666
SYP42_ARATH	SYP42	physical	10888666
SYP41_ARATH	SYP41	physical	10888666

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.