VPS25_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VPS25_MOUSE
• UniProt AC: Q9CQ80
• Protein Name: Vacuolar protein-sorting-associated protein 25
• Gene Name: Vps25
• Organism: Mus musculus (Mouse).
• Sequence Length: 176
• Subcellular Localization: Cytoplasm. Endosome membrane. Nucleus. Distributes diffusely throughout the cytoplasm and nucleoplasm, but exhibits a punctate distribution on coexpression with CHMP6..
• Protein Description: Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL (By similarity)..
• Protein Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTSGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MAMSFEWPWQY ----CCCCCCCCCCC	15.52	25338131
18	Phosphorylation	YRFPPFFTLQPNVDT CCCCCCEEECCCCCH	25.51	28059163
141 (in isoform 2)	Phosphorylation	-	5.35	17203969
142 (in isoform 2)	Phosphorylation	-	38.90	17203969
148 (in isoform 2)	Phosphorylation	-	25.03	17203969
168	Phosphorylation	KAEIITVSDGRGVKF CCEEEEEECCCCCCC	26.20	24759943

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VPS25_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VPS25_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VPS25_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPAG1_HUMAN	SPAG1	physical	26496610
SNF8_HUMAN	SNF8	physical	26496610
VPS36_HUMAN	VPS36	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.