UniProt ID | VP372_ARATH | |
---|---|---|
UniProt AC | Q3EBL9 | |
Protein Name | Vacuolar protein-sorting-associated protein 37 homolog 2 | |
Gene Name | VPS37-2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 218 | |
Subcellular Localization | Endosome. | |
Protein Description | Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) (By similarity).. | |
Protein Sequence | MFNFWGSKEQQQGQSRPSPEASATPWYSPSLVTSPSSSRPQTSGQIPSHVSPGEAAGIIAILKDKSVDELRKLLSDKDAYQQFLHSLDQVTIQNNIREELRKETLHLARENLEKEPQIVELRNQCRIIRTSELATAQEKLNELENQREEILKFYSPGSLLHRLQDAMNQVDEESEELQQKFMEKDIDTAAFVQKYKKLRSKYHRRALIHLAAKTSSIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VP372_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VP372_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VP372_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...