UniProt ID | VMP1_RAT | |
---|---|---|
UniProt AC | Q91ZQ0 | |
Protein Name | Vacuole membrane protein 1 | |
Gene Name | Vmp1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 406 | |
Subcellular Localization |
Endoplasmic reticulum-Golgi intermediate compartment membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. Vacuole membrane Multi-pass membrane protein. Endoplasmic reticulum. Colocalizes with MAP1LC3A and BECN1 in 293T |
|
Protein Description | Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion (By similarity). Plays an essential role in formation of cell junctions (By similarity). Plays a role in the initial stages of the autophagic process through its interaction with BECN1.. | |
Protein Sequence | MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLETLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQGENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAENGTNCD ------CCCCCCCCH | 20.97 | - | |
23 | Phosphorylation | SKEQHNGSFTDPSSV CCCHHCCCCCCHHHH | 30.23 | 29779826 | |
25 | Phosphorylation | EQHNGSFTDPSSVNE CHHCCCCCCHHHHCH | 49.01 | 27097102 | |
29 | Phosphorylation | GSFTDPSSVNEKKRR CCCCCHHHHCHHHHC | 34.06 | 28689409 | |
224 | Phosphorylation | AEPDDEEYQEFEEML CCCCHHHHHHHHHHH | 15.99 | 22276854 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VMP1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VMP1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VMP1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BECN1_HUMAN | BECN1 | physical | 23316280 | |
PK3C3_HUMAN | PIK3C3 | physical | 23316280 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...