VMP1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VMP1_RAT
• UniProt AC: Q91ZQ0
• Protein Name: Vacuole membrane protein 1
• Gene Name: Vmp1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 406
• Subcellular Localization: Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein. Endoplasmic reticulum. Colocalizes with MAP1LC3A and BECN1 in 293T
• Protein Description: Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion (By similarity). Plays an essential role in formation of cell junctions (By similarity). Plays a role in the initial stages of the autophagic process through its interaction with BECN1..
• Protein Sequence: MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLETLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQGENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAENGTNCD ------CCCCCCCCH	20.97	-
23	Phosphorylation	SKEQHNGSFTDPSSV CCCHHCCCCCCHHHH	30.23	29779826
25	Phosphorylation	EQHNGSFTDPSSVNE CHHCCCCCCHHHHCH	49.01	27097102
29	Phosphorylation	GSFTDPSSVNEKKRR CCCCCHHHHCHHHHC	34.06	28689409
224	Phosphorylation	AEPDDEEYQEFEEML CCCCHHHHHHHHHHH	15.99	22276854

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VMP1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VMP1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VMP1_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BECN1_HUMAN	BECN1	physical	23316280
PK3C3_HUMAN	PIK3C3	physical	23316280

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.